Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
21072-1-AP targets MEKK3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15223 Product name: Recombinant human MAP3K3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 281-366 aa of BC090859 Sequence: VSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGK Predict reactive species |
| Full Name | mitogen-activated protein kinase kinase kinase 3 |
| Calculated Molecular Weight | 657 aa, 74 kDa |
| Observed Molecular Weight | 71 kDa, 74 kDa |
| GenBank Accession Number | BC090859 |
| Gene Symbol | MEKK3 |
| Gene ID (NCBI) | 4215 |
| RRID | AB_2878806 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99759 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mitogen-activated protein/ERK kinase kinase 3 (MEKK3) is a member of a family of MEKK/Ste11 serine/threonine protein kinases. One function of MEKK3 is to serve as an upstream regulatory kinase in the mitogen-activated protein kinase cascade, however, it also plays a critical role in other signaling pathways. MEKK3 regulates several important functions including cell survival and proliferation. It is ubiquitously expressed in multiple tissues and has been found in complexes with scaffold proteins and other kinases. (PMID: 18206350).Cerebral cavernous malformations (CCMs) complex regulation of MEKK3 is essential during vertebrate heart development. MEKK3 signalling and KLF2/4 may be targeted to develop new CCM therapeutics.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MEKK3 antibody 21072-1-AP | Download protocol |
| IP protocol for MEKK3 antibody 21072-1-AP | Download protocol |
| WB protocol for MEKK3 antibody 21072-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oncogene MEKK2 and MEKK3 suppress Hedgehog pathway-dependent medulloblastoma by inhibiting GLI1 function. | ||
Biomed Pharmacother Buparlisib and ponatinib inhibit aggressiveness of cholangiocarcinoma cells via suppression of IRS1-related pathway by targeting oxidative stress resistance | ||
Sci Rep Treadmill training improves lung function and inhibits alveolar cell apoptosis in spinal cord injured rats |







