Tested Applications
Positive WB detected in | Jurkat cells, mouse spleen tissue, Raji cells, HL-60 cells, A431 cells, human liver tissue, HEK-293T cells, human brain tissue, K-562 cells, MCF-7 cells, HeLa cells |
Positive IP detected in | Raji cells |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells |
Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 11 publications below |
WB | See 133 publications below |
IHC | See 16 publications below |
IF | See 7 publications below |
IP | See 6 publications below |
CoIP | See 1 publications below |
Product Information
16225-1-AP targets MCL1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10397 Product name: Recombinant human MCL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-327 aa of BC107735 Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG Predict reactive species |
Full Name | myeloid cell leukemia sequence 1 (BCL2-related) |
Calculated Molecular Weight | 350 aa, 37 kDa |
Observed Molecular Weight | 35-40 kDa |
GenBank Accession Number | BC107735 |
Gene Symbol | MCL1 |
Gene ID (NCBI) | 4170 |
RRID | AB_2143977 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q07820 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target. MCL-1 can be alternatively spliced into a long form (MCL-1L, 40 kDa) or a short form (MCL-1S, 30 kDa). (PMID: 15467463, PMID: 15147382)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MCL1 antibody 16225-1-AP | Download protocol |
IHC protocol for MCL1 antibody 16225-1-AP | Download protocol |
IF protocol for MCL1 antibody 16225-1-AP | Download protocol |
IP protocol for MCL1 antibody 16225-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell The mitochondrial DNAJC co-chaperone TCAIM reduces α-ketoglutarate dehydrogenase protein levels to regulate metabolism | ||
Nat Commun MCL-1 gains occur with high frequency in lung adenocarcinoma and can be targeted therapeutically. | ||
Nat Commun Small-molecule suppression of calpastatin degradation reduces neuropathology in models of Huntington's disease. | ||
Nat Commun IFN-β is a macrophage-derived effector cytokine facilitating the resolution of bacterial inflammation. | ||
EBioMedicine The LIV-1-GRPEL1 axis adjusts cell fate during anti-mitotic agent-damaged mitosis. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Eya (Verified Customer) (07-06-2021) | the bands appear very clear
|