Tested Applications
Positive WB detected in | BGC-823 cells, mouse brain tissue, HEK-293 cells, SGC-7901 cells, SKOV-3 cells, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
IF | See 3 publications below |
Product Information
30007-1-AP targets LGR5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag31625 Product name: Recombinant human LGR5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 824-907 aa of BC096324 Sequence: NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL Predict reactive species |
Full Name | leucine-rich repeat-containing G protein-coupled receptor 5 |
Calculated Molecular Weight | 907 aa, 100 kDa |
Observed Molecular Weight | 100 kDa |
GenBank Accession Number | BC096324 |
Gene Symbol | LGR5 |
Gene ID (NCBI) | 8549 |
RRID | AB_3086207 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75473 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5) also known as G-protein coupled receptor 49 (GPR49) or G-protein coupled receptor 67 (GPR67) is a protein that in humans is encoded by the LGR5 gene. It is a member of GPCR class A receptor proteins. R-spondin proteins are the biological ligands of LGR5. LGR5 is expressed across a diverse range of tissue such as in the muscle, placenta, spinal cord and brain and particularly as a biomarker of adult stem cells in certain tissues.LGR5 is crucial during embryogenesis as LGR null studies in mice incurred 100% neonatal mortality accompanied by several craniofacial distortions such as ankyloglossia and gastrointestinal dilation (PMID: 9642114, 16575208, 525477).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LGR5 antibody 30007-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Burns Trauma Nocardia rubra cell-wall skeleton mitigates whole abdominal irradiation-induced intestinal injury via regulating macrophage function | ||
Acta Histochem Stimulation of mouse hair regrowth by exosomes derived from human umbilical cord mesenchymal stem cells | ||
Zool Res Peptide Cy RL-QN15 accelerates hair regeneration in diabetic mice by binding to the Frizzled-7 receptor | ||
Int J Biol Macromol Integrated bulk and single-cell RNA sequencing unveils the temporal and spatial dynamics of epidermal cell adhesion |