Use Able AI chat for product recommendations

LGALS3BP Monoclonal antibody

LGALS3BP Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 60066-1-Ig
Clone No. 2D8E11
Publications (5)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

2D8E11, 90K, BTBD17B, Galectin 3 binding protein, Galectin-3-binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LGALS3BP in ?

Tested Applications

Positive WB detected inhuman blood tissue
Positive IP detected inhuman plasma tissue
Positive IHC detected inhuman breast cancer tissue, human oesophagus cancer tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60066-1-Ig targets LGALS3BP in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0294

Product name: Recombinant human LGALS3BP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 6-221 aa of BC002403

Sequence: LFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITL

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3 binding protein
Calculated Molecular Weight 585 aa, 65 kDa
Observed Molecular Weight 65-90 kDa
GenBank Accession NumberBC002403
Gene Symbol LGALS3BP
Gene ID (NCBI) 3959
RRIDAB_2265800
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08380
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ). LGALS3BP has a predicted mass of ∼65 kDa. It is heavily glycosylated and shows an apparent molecular weight of 90 kDa on SDS-PAGE.

Protocols

Product Specific Protocols
IF protocol for LGALS3BP antibody 60066-1-IgDownload protocol
IHC protocol for LGALS3BP antibody 60066-1-IgDownload protocol
IP protocol for LGALS3BP antibody 60066-1-IgDownload protocol
WB protocol for LGALS3BP antibody 60066-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-LGALS3BP (Galectin-3-binding protein) antibody (Cat# 60066-1-Ig) has 5 total citations published in Invest Ophthalmol Vis Sci, PLoS Pathog, Sci Rep, Proteomics, and bioRxiv. Research fields span retinal angiogenesis under hypoxia, antiviral innate immune responses, lung adenocarcinoma progression via the NF-κB axis, plasma-derived extracellular vesicle proteomics, and heparan sulfate sulfation regulation. Applications include WB and IHC in human and mouse samples.

SpeciesApplicationTitle
humanWB

Invest Ophthalmol Vis Sci

LGALS3BP in Microglia Promotes Retinal Angiogenesis Through PI3K/AKT Pathway During Hypoxia.

Authors - Chenyang Zhao
mouseWB

PLoS Pathog

Inducible LGALS3BP/90K activates antiviral innate immune responses by targeting TRAF6 and TRAF3 complex.

Authors - Gang Xu
mouseIHC

Sci Rep

The P4HB/LGALS3BP/NF-kB axis promotes the progression of MIA to IAC in lung adenocarcinoma.

Authors - Guang Mu
humanWB

Proteomics

Combination of size-exclusion chromatography and ion exchange adsorption for improving the proteomic analysis of plasma-derived extracellular vesicles

Authors - Yaojie Wang
humanWB

bioRxiv

Galectin-3-binding protein inhibits extracellular heparan 6-O-endosulfatse Sulf-2

Authors - Aswini Panigrahi
Loading...
||
New chat

Able™

正在加载,请稍候...