KIRREL2 Polyclonal antibody

• 

  WB analysis of mouse liver using 10890-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10890-1-AP (KIRREL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

KIRREL2 Polyclonal Antibody for WB, ELISA

Cat No. 10890-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

Kin of irregular chiasm-like protein 2, Kin of IRRE-like protein 2, NEPH3, Nephrin-like protein 3, UNQ5827/PRO19646

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 3 publications below

Product Information

10890-1-AP targets KIRREL2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1036

  Product name: Recombinant human KIRREL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-219 aa of BC007312

  Sequence: MLRMRVPALLVLLFCFRGRAGPSPHFLQQPEDLVVLLGEGGAQASLGRRASASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV

• Full Name: kin of IRRE like 2 (Drosophila)
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 67 kDa, 90 kDa
• GenBank Accession Number: BC007312
• Gene Symbol: KIRREL2
• Gene ID (NCBI): 84063
• RRID: AB_2130842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UWL6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Stem Cell; Human cerebellar organoids with functional Purkinje cells; Authors - Alexander Atamian
human	IF	Nat Protoc; Generation and long-term culture of human cerebellar organoids from pluripotent stem cells; Authors - Alexander Atamian
human	IF	Life Med; CRISPR/Cas9-mediated genetic correction reverses spinocerebellar ataxia 3 disease-associated phenotypes in differentiated cerebellar neurons; Authors - Guoxu Song