• Featured Product
  • KD/KO Validated

Integrin Alpha V Polyclonal antibody

Integrin Alpha V Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 27096-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

ITGAV, CD51, Integrin alpha-V, Integrin alpha-V heavy chain, Integrin alpha-V light chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, A549 cells, MCF-7 cells, human placenta tissue
Positive IHC detected inmouse kidney tissue, human breast cancer tissue, human liver cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells
Positive FC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27096-1-AP targets Integrin Alpha V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25825

Product name: Recombinant human ITGAV protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 819-915 aa of BC136442

Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ

Predict reactive species
Full Name integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
Calculated Molecular Weight 1048 aa, 116 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC136442
Gene Symbol Integrin alpha V
Gene ID (NCBI) 3685
RRIDAB_2880753
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06756
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis.

Protocols

Product Specific Protocols
IF protocol for Integrin Alpha V antibody 27096-1-APDownload protocol
IHC protocol for Integrin Alpha V antibody 27096-1-APDownload protocol
WB protocol for Integrin Alpha V antibody 27096-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Theranostics

Hypoxia-induced TGFBI maintains glioma stem cells by stabilizing EphA2

Authors - Zirong Chen
ratWB

Aging Cell

Fibronectin type III domain-containing 5 improves aging-related cardiac dysfunction in mice.

Authors - Can Hu
  • KD Validated
humanWB

Curr Biol

The viral restriction factor tetherin/BST2 tethers cytokinetic midbody remnants to the cell surface.

Authors - Adrien Presle
humanWB,IHC

Int J Mol Sci

Macrophages Cytokine Spp1 Increases Growth of Prostate Intraepithelial Neoplasia to Promote Prostate Tumor Progression.

Authors - Justin K Messex
humanWB

Cell Signal

C1GALT1 high expression enhances the progression of glioblastoma through the EGFR-AKT/ERK cascade

Authors - Yanting Su
humanWB

Int J Mol Sci

Identification of Novel microRNA Profiles Dysregulated in Plasma and Tissue of Abdominal Aortic Aneurysm Patients.

Authors - Emma Plana

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Laura (Verified Customer) (08-28-2025)

It worked well with the protocol provided on the website

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Oligodendrocytes
FH

Alex (Verified Customer) (03-31-2025)

Exceptional focal adhesion staining in LN229 cells. Identity of the nuclear stain is unknown. Grayscale = Itgav antibody at 1:200. 4% formaldehyde fixation (methanol-free) with 0.1% Triton X-100 permeabilisation. Blocked in 2% BSA / 0.1% Triton X-100.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Neural - LN229
Integrin Alpha V Antibody Immunofluorescence validation (1:200 dilution) in Neural - LN229 (Cat no:27096-1-AP)
FH

Boyan (Verified Customer) (04-24-2019)

By WB, this antibody gave a clean band at the expected molecular weight; by IF, it could not label a specific pattern.

  • Applications: Western Blot, Immunofluorescence,
  • Cell Tissue Type: MEF
Loading...
||
New chat Able
正在加载,请稍候...