Tested Applications
| Positive WB detected in | THP-1 cells, SH-SY5Y cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10547-1-AP targets IRF5 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0841 Product name: Recombinant human IRF5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 173-498 aa of BC004201 Sequence: TLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ Predict reactive species |
| Full Name | interferon regulatory factor 5 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC004201 |
| Gene Symbol | IRF5 |
| Gene ID (NCBI) | 3663 |
| RRID | AB_2280474 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13568 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IRF5, also named as SLEB10, contians one IRF tryptophan pentad repeat DNA-binding domain and belongs to the IRF family. It is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. It is activated by TLR7 or TLR8 signaling. Genetic variations in IRF5 are associated with susceptibility to inflammatory bowel disease type 14 (IBD14) and systemic lupus erythematosus type 10 (SLEB10). Alternative splice variant encoding different isoforms exist. Catalog#10547-1-AP is a rabbit polyclonal antibody raised against the C-terminal of human IRF5.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IRF5 antibody 10547-1-AP | Download protocol |
| IF protocol for IRF5 antibody 10547-1-AP | Download protocol |
| IHC protocol for IRF5 antibody 10547-1-AP | Download protocol |
| IP protocol for IRF5 antibody 10547-1-AP | Download protocol |
| WB protocol for IRF5 antibody 10547-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-IRF5 (Interferon Regulatory Factor 5) antibody, catalog number 10547-1-AP, has accumulated 44 total citations published across 37 journals, including Nature Communications, Nature Aging, Journal of Biological Chemistry, PLoS ONE, Frontiers in Immunology, and FEBS Journal. Associated research fields span immunology, inflammation, fibrosis, cancer biology, macrophage polarization, asthma, viral infection, and transplantation.
| Species | Application | Title |
|---|---|---|
Nat Aging DNA damage in macrophages drives immune autoreactivity via nuclear antigen presentation. | ||
Nat Commun Early macrophage response to obesity encompasses Interferon Regulatory Factor 5 regulated mitochondrial architecture remodelling | ||
J Control Release PEGylation of interleukin-10 improves the pharmacokinetic profile and enhances the antifibrotic effectivity in CCl?-induced fibrogenesis in mice. | ||
J Immunother Cancer Ccl3 enhances docetaxel chemosensitivity in breast cancer by triggering proinflammatory macrophage polarization. | ||
Phytomedicine Sedum sarmentosum Bunge extract alleviates inflammation and kidney injury via inhibition of M1-macrophage polarization. |
