IL-23 p19 Monoclonal antibody

IL-23 p19 Monoclonal Antibody for IHC, ELISA
Cat No. 66196-1-Ig
Clone No.1D5D3

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

IL23A, IL-23 subunit alpha, IL 23p19, IL 23A, IL 23 subunit alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman stomach cancer tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66196-1-Ig targets IL-23 p19 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19406

Product name: Recombinant human IL-23A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 17-189 aa of BC066268

Sequence: AQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Predict reactive species
Full Name interleukin 23, alpha subunit p19
Calculated Molecular Weight 189 aa, 21 kDa
GenBank Accession NumberBC066268
Gene Symbol IL23A
Gene ID (NCBI) 51561
RRIDAB_2881589
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NPF7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin 23 (IL-23) is a member of the IL12 cytokine family and composed of two subunits, IL12p40 and IL23p19. It is produced by antigen presenting cells and has been shown to promote the production and survival of a distinct lineage of T-cells called TH17 cells. A functional receptor for IL-23 (the IL-23 receptor) has been identified and is composed of Il-12Rβ1 and IL-23R. IL-23 is expressed chiefly by the macrophages and DCs. The IL-23R is found on memory T cells, NKT cells, macrophages, DCs, and naive T cells upon activation by TGF-βand IL-6. The main biological effects of IL-23 identified initially consist of stimulation of antigen presentation by DCs, T cell differentiation to Th17 cells, and production of interferon-γ (IFN-γ). IL-23 acts also as an end-stage effector cytokine through direct action on macrophages.

Protocols

Product Specific Protocols
IHC protocol for IL-23 p19 antibody 66196-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Thyroid

A MULTICENTER, SINGLE-BLIND, CASE-CONTROL, IMMUNOHISTOCHEMICAL STUDY OF ORBITAL TISSUE IN THYROID EYE DISEASE

Authors - YuanPing Hai
human

J Immunol

Polarization and β-Glucan Reprogram Immunomodulatory Metabolism in Human Macrophages and Ex Vivo in Human Lung Cancer Tissues

Authors - Teresa W-M Fan
humanWB,IF

Cancer Lett

PDE4D/cAMP/IL-23 axis determines the immunotherapy efficacy of lung adenocarcinoma via activating the IL-9 autocrine loop of cytotoxic T lymphocytes

Authors - Bing Feng
humanIHC

Sci Rep

Chemotherapy-induced high expression of IL23A enhances efficacy of anti-PD-1 therapy in TNBC by co-activating the PI3K-AKT signaling pathway of CTLs

Authors - Fan Pan
mouseELISA

Toxicol Res (Camb)

Zerumbone attenuates the excessive proliferation of keratinocytes in psoriasis mice through regulating NLRP3/NF-κB pathway

Authors - Jin Lin
humanWB

Gut

IL23 induces IL23R recycling and amplifies innate receptor-induced signalling and cytokines in human macrophages, and the IBD-protective IL23R R381Q variant modulates these outcomes.

Authors - Rui Sun
Loading...
||
New chat Able
正在加载,请稍候...