Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IFT81 Polyclonal antibody

IFT81 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Carnitine deficiency-associated protein expressed in ventricle 1, CDV 1, CDV 1R, CDV1, CDV-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IFT81 in ?

Tested Applications

Positive WB detected inmouse brain tissue, mouse testis tissue, HEK-293 cells, human brain tissue, rat testis tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC2C12 cells, hTERT-RPE1 cells, MDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11744-1-AP targets IFT81 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2339

Product name: Recombinant human IFT81 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 550-676 aa of BC029349

Sequence: VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL

Predict reactive species
Full Name intraflagellar transport 81 homolog (Chlamydomonas)
Calculated Molecular Weight 676 aa, 80 kDa
Observed Molecular Weight 75-80 kDa
GenBank Accession NumberBC029349
Gene Symbol IFT81
Gene ID (NCBI) 28981
RRIDAB_2121966
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WYA0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT particles are multi-subunit complexes of proteins that functions to move non-membrane-bound particles from the cell body to the tip of cilium or flagellum, then return them to the cell body. Transport towards the ciliary tip is regulated by the IFT complex B (IFT-B), consisting of at least 15 IFT proteins, in association with kinesin motors, whereas transport from the ciliary tip back to the base is executed by a dynein motor in association with the IFT complex A (IFT-A), currently known to be composed of six IFT proteins. IFT81 is a subunit of IFT complex B.It may play a role in development of the testis and spermatogenesis. There are some isoforms of IFT81 with 73-78 kDa and 43-50 kDa.

Protocols

Product Specific Protocols
IF protocol for IFT81 antibody 11744-1-APDownload protocol
IHC protocol for IFT81 antibody 11744-1-APDownload protocol
IP protocol for IFT81 antibody 11744-1-APDownload protocol
WB protocol for IFT81 antibody 11744-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The IFT81 polyclonal antibody (Cat# 11744-1-AP) has accumulated 58 citations published in high-impact journals including Cell, Nature Cell Biology, Nature Communications, Developmental Cell, EMBO Journal, Journal of Cell Biology, eLife, Science Reports, and Human Molecular Genetics. Associated research fields encompass ciliogenesis, intraflagellar transport, Hedgehog and Wnt signaling pathways, ciliopathies, male fertility and spermatogenesis, polycystic kidney disease, and cancer biology.

SpeciesApplicationTitle
mouseIF

Cell

Dynamic Remodeling of Membrane Composition Drives Cell Cycle through Primary Cilia Excision.

Authors - Siew Cheng Phua
humanWB

Nat Cell Biol

Systematic proteomics of the VCP-UBXD adaptor network identifies a role for UBXN10 in regulating ciliogenesis.

Authors - Malavika Raman
mouseIF

Nat Cell Biol

The kinesin-4 protein Kif7 regulates mammalian Hedgehog signalling by organizing the cilium tip compartment.

Authors - Mu He
mouseIF

Kidney Int

Ttc21b deficiency attenuates autosomal dominant polycystic kidney disease in a kidney tubular- and maturation-dependent manner

Authors - Wei Wang
humanWB

Nat Commun

IFT proteins spatially control the geometry of cleavage furrow ingression and lumen positioning.

Authors - Nicolas Taulet
mouseWB

Nat Commun

Cilia locally synthesize proteins to sustain their ultrastructure and functions.

Authors - Kai Hao
Loading...
||
New chat

Able™

正在加载,请稍候...