Tested Applications
Positive WB detected in | PMA, Ionomycin and Brefeldin A treated NK-92 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28722-1-AP targets IFN-gamma in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30371 Product name: Recombinant human IFNG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 85-161 aa of BC070256 Sequence: DDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Predict reactive species |
Full Name | IFN gamma |
Calculated Molecular Weight | 166 aa, 19 kDa |
Observed Molecular Weight | 20-25 kDa |
GenBank Accession Number | BC070256 |
Gene Symbol | IFNG |
Gene ID (NCBI) | 3458 |
ENSEMBL Gene ID | ENSG00000111537 |
RRID | AB_3086082 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P01579 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interferon gamma (IFNG) is a soluble cytokine that is the only member of the type II class of interferons. It is secreted by Th1 cells, cytotoxic T cells and NK cells. The cytokine is associated with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. It plays crucial roles in pathogen clearance. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. It has been identified in many studies as a biomarker for pleural tuberculosis (TB). Mutations in this gene are associated with aplastic anemia.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IFN-gamma antibody 28722-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |