IFN-gamma Polyclonal antibody, PBS Only

• 

  WB analysis using 15365-1-AP (same clone as 15365-1-PBS)

  PMA, Ionomycin and Brefeldin A treated NK-92 cells were subjected to SDS PAGE followed by western blot with 15365-1-AP (IFN Gamma antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15365-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Recombinant protein using 15365-1-AP (same clone as 15365-1-PBS)

  Recombinant human IFN gamma protein (cat.NO. HZ-1301) were subjected to SDS PAGE followed by western blot with 15365-1-AP (IFN gamma antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15365-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 15365-1-AP (same clone as 15365-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 15365-1-AP (IFN Gamma antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15365-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

IFN-gamma Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15365-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

IFNG, IFG, IFN gamma, IFN γ, IFNγ

---

Product Information

15365-1-PBS targets IFN-gamma in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8321

  Product name: Recombinant human IFNG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-166 aa of BC070256

  Sequence: YCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

• Full Name: IFN gamma
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC070256
• Gene Symbol: IFNG
• Gene ID (NCBI): 3458
• ENSEMBL Gene ID: ENSG00000111537
• RRID: AB_2123037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01579
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IFN gamma (IFNG) is a soluble cytokine that is the only member of the type II class of IFN. It is secreted by Th1 cells, cytotoxic T cells and NK cells. The cytokine is associated with antiviral, immunoregulatory and anti-tumor properties and is a potent activator of macrophages. It plays crucial roles in pathogen clearance. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. It has been identified in many studies as a biomarker for pleural tuberculosis (TB). Mutations in this gene are associated with aplastic anemia.