"Histone H3 Antibodies" Comparison
View side-by-side comparison of Histone H3 antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | HEK-293 cells, Hela cells, HepG cells, MCF-7 cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human oesophagus cancer tissue, human skin cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:600-1:2400 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17168-1-AP targets Histone H3 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA, IB applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken, goat, yeast, arabidopsis, yellow catfish, deer |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10644 Product name: Recombinant human Histone-H3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-136 aa of BC015544 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species |
| Full Name | histone cluster 2, H3a |
| Calculated Molecular Weight | 136 aa, 15 kDa |
| Observed Molecular Weight | 15-17 kDa |
| GenBank Accession Number | BC015544 |
| Gene Symbol | Histone H3 |
| Gene ID (NCBI) | 333932 |
| RRID | AB_2716755 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q71DI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| IF protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| IHC protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| IP protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| WB protocol for Histone H3 antibody 17168-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Histone H3 Polyclonal antibody (Cat# 17168-1-AP) has accumulated 1,588 citations across high-impact journals including Nature, Cell, Science, Nature Communications, Nature Cell Biology, Molecular Cell, Cancer Research, Autophagy, and Signal Transduction and Targeted Therapy. Research fields span epigenetics (histone lactylation, acetylation, methylation), oncology, immunology, metabolism, neurodegeneration, cardiovascular disease, autophagy, DNA repair, and plant biology. The antibody is primarily used for Western blotting, with additional applications in ChIP, IF, IP, and IHC.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Nucleosome assembly protein-like 1 degradation-dependent novel cardioprotection mechanism of Wnt2 against ischemia‒reperfusion injury | ||
Signal Transduct Target Ther The deubiquitylase UCHL3 maintains cancer stem-like properties by stabilizing the aryl hydrocarbon receptor. | ||
Signal Transduct Target Ther Discovery of IHMT-337 as a potent irreversible EZH2 inhibitor targeting CDK4 transcription for malignancies | ||
Signal Transduct Target Ther Histone deacetylase inhibitors promote breast cancer metastasis by elevating NEDD9 expression | ||
Signal Transduct Target Ther Sodium nitrate protects against metabolic syndrome by sialin-mediated macrophage rebalance | ||
Signal Transduct Target Ther Gut dysbiosis conveys psychological stress to activate LRP5/β-catenin pathway promoting cancer stemness |
Reviews
What customers say
Across 14 reviews, this Histone H3 antibody is overwhelmingly positive (average ~4.6/5). Most users report excellent Western Blot performance with a clear single band at the expected ~17 kDa across diverse samples including HeLa, iPSC-derived cells, mouse/bovine/porcine tissues, and yeast. Recommended dilutions range from 1:500 to 1:15,000. A few users also achieved good IHC and IF results. Minor concerns include occasional nonspecific bands (~30 kDa) in yeast extracts and one failed IF attempt on skin cryosections. Overall, reviewers describe it as reliable, specific, and cost-effective.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Charlotte (Verified Customer) (02-19-2026) | We have one single clear band at the expected size (10 kDa).
 |
Nishita (Verified Customer) (01-19-2026) | A fair bit of off-target binding, but still shows clear histone signals at lower MW. There are usually 2-3 bands for the histones, and a strong nonspecific band at around 30kDa.
|
Felipe (Verified Customer) (07-24-2025) | Histone H3 antibody is a reliable marker for detecting proliferating cells. After optimizing the dilution, I achieved good results in identifying proliferative cells in bovine ovarian tissue using an immunofluorescence assay.
 |
Christin (Verified Customer) (06-14-2025) | Antibody worked very vell for western blot using iPSC-derived macrophages and microglia
|
kis (Verified Customer) (02-21-2025) | This antibody gave u satisfactory results in our cell line for Western blot (WB) analysis.
|
Parijat (Verified Customer) (08-19-2024) | Worked on blot.
|
Wissem (Verified Customer) (06-27-2024) | Antibody works very well at detecting Histone H3 in extracts from U2OS, HCT116, HeLa, RPE1 and HEK293 cells - used at 1:10,000 to 1:15,000 incubated overnight at 4C
|
Roy (Verified Customer) (06-12-2024) | This antibody is great at detecting Histone H3 by WB (1/1000- 1h incubation at RT) with beautiful enrichment at the purified chromatin fraction.
|
Mi (Verified Customer) (06-25-2023) | It works very well in nuclear extracts from human brown adipocyte cells.
|
Veda (Verified Customer) (04-29-2022) | IF staining test in cryo sections of skin. It does not seem to work. Maybe it only stains the nuclear membrane.
|
Pradeep (Verified Customer) (09-19-2020) | Good antibody for Western blot. Selvaraju, V., Thirunavukkarasu, M., Joshi, M. et al. Deletion of newly described pro-survival molecule Pellino-1 increases oxidative stress, downregulates cIAP2/NF-κB cell survival pathway, reduces angiogenic response, and thereby aggravates tissue function in mouse ischemic models. Basic Res Cardiol 115, 45 (2020). https://doi.org/10.1007/s00395-020-0804-4
|
Tanusree (Verified Customer) (12-03-2019) | The antibody works great in Western blotting analysis.
|
Ruiting (Verified Customer) (11-11-2019) | I use the Proteintech antibodies almost every week, the antibodies never failed to me. Very gald to use their products with a great price.Ruiting
|
Robert (Verified Customer) (07-18-2019) | The Histon H3 antibody gives a signal in the three nuclear samples, but not in the cytoplasmic samples.
 |
