• Featured Product
  • KD/KO Validated

GRP75 Polyclonal antibody

GRP75 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 14887-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

HSPA9, 75 kDa glucose-regulated protein, CSA, GRP-75, Heat shock 70 kDa protein 9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, A549 cells, mouse testis tissue, Jurkat cells, NIH/3T3 cells, mouse liver
Positive IP detected inmouse brain tissue, NIH/3T3 cells
Positive IHC detected inhuman normal colon
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14887-1-AP targets GRP75 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse, rat, chicken, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6673

Product name: Recombinant human GRP75 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 331-679 aa of BC000478

Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

Predict reactive species
Full Name heat shock 70kDa protein 9 (mortalin)
Calculated Molecular Weight 74 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC000478
Gene Symbol GRP75
Gene ID (NCBI) 3313
RRIDAB_2120458
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP38646
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. This antibody recognized the endogenous GRP75 protein in NIH/3T3 cells. (PMID: 21640711, 22920904)

Protocols

Product Specific Protocols
IF protocol for GRP75 antibody 14887-1-APDownload protocol
IHC protocol for GRP75 antibody 14887-1-APDownload protocol
IP protocol for GRP75 antibody 14887-1-APDownload protocol
WB protocol for GRP75 antibody 14887-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

The mitochondrial DNAJC co-chaperone TCAIM reduces α-ketoglutarate dehydrogenase protein levels to regulate metabolism

Authors - Wang Jiahui
  • KD Validated
humanWB

Cell Metab

DNAJC19, a mitochondrial cochaperone associated with cardiomyopathy, forms a complex with prohibitins to regulate cardiolipin remodeling.

Authors - Ricarda Richter-Dennerlein
humanWB

Nat Commun

LONP1 and mtHSP70 cooperate to promote mitochondrial protein folding.

Authors - Chun-Shik Shin
mouse

EMBO Mol Med

Excess hydrogen sulfide and polysulfides production underlies a schizophrenia pathophysiology.

Authors - Masayuki Ide
mouseWB

J Cell Biol

Loss of OMA1 delays neurodegeneration by preventing stress-induced OPA1 processing in mitochondria.

Authors - Anne Korwitz
ratWB

Cell Death Dis

Pathological convergence of APP and SNCA deficiency in hippocampal degeneration of young rats

Authors - Yajie Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lenie (Verified Customer) (07-18-2025)

IF worked. WB did not on zebrafish tissue and human patient. Could you perhaps provide me with another protocol?

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/5000 (WB), 1/200 (IF)
  • Cell Tissue Type: Zebrafish
GRP75 Antibody Western Blot,Immunofluorescence validation (1/5000 (WB), 1/200 (IF) dilution) in Zebrafish (Cat no:14887-1-AP)
FH

Anastasia (Verified Customer) (08-07-2024)

Deyolked zebrafish embryos

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Zebrafish embryos
GRP75 Antibody Western Blot validation (1:1000 dilution) in Zebrafish embryos (Cat no:14887-1-AP)
FH

Christina (Verified Customer) (11-14-2023)

I used this antibody for HeLa extracts in Western Blot and worked perfectly.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HeLa cells
FH

Ning (Verified Customer) (02-27-2023)

Specifically probe endogenous GRP75 with a right MW.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse brain lysate
GRP75 Antibody Western Blot validation (1:2000 dilution) in mouse brain lysate (Cat no:14887-1-AP)
FH

Staci (Verified Customer) (02-02-2023)

Antibody works very well with GRP75. Very little non-specific binding on immunoblot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1,000
  • Cell Tissue Type: Mouse Islet protein lysates
Loading...
||
New chat Able
正在加载,请稍候...