Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, K-562 cells, HepG2 cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse colon tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 37 publications below |
| IHC | See 11 publications below |
| IF | See 6 publications below |
| IP | See 2 publications below |
| RIP | See 4 publications below |
Product Information
11760-1-AP targets HNRNPC in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2356 Product name: Recombinant human HNRNPC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC003394 Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS Predict reactive species |
| Full Name | heterogeneous nuclear ribonucleoprotein C (C1/C2) |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa, 36-40 kDa |
| GenBank Accession Number | BC003394 |
| Gene Symbol | HNRNPC |
| Gene ID (NCBI) | 3183 |
| RRID | AB_2117500 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07910 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| IHC protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| IP protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| WB protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. | ||
Nat Struct Mol Biol Alternative polyadenylation by sequential activation of distal and proximal PolyA sites. | ||
Adv Sci (Weinh) m6A-Modified circTET2 Interacting with HNRNPC Regulates Fatty Acid Oxidation to Promote the Proliferation of Chronic Lymphocytic Leukemia
| ||
Nucleic Acids Res Sequence-dependent recruitment of SRSF1 and SRSF7 to intronless lncRNA NKILA promotes nuclear export via the TREX/TAP pathway. | ||
Clin Transl Med LncRNA BC promotes lung adenocarcinoma progression by modulating IMPAD1 alternative splicing |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Juliette (Verified Customer) (07-09-2025) | Works very well in WB (dilution = 1:10 000), in immunofluorescence and in immunoprecipitation.
|
FH Tatyana (Verified Customer) (12-04-2023) | Works very well in ICC (nuclear staining) but extra bands in WB
![]() |


















