HNRNPC Polyclonal antibody

• 

  WB analysis of HeLa using 11760-1-AP

  WB result of HNRNPC antibody (11760-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HNRNPC transfected HeLa cells.

• 

  WB analysis using 11760-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11760-1-AP (HNRNPC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 11760-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11760-1-AP (HNRNPC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11760-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11760-1-AP (HNRNPC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11760-1-AP

  IP result of anti-HNRNPC (IP:11760-1-AP, 4ug; Detection:11760-1-AP 1:10000) with HeLa cells lysate 1360 ug.

• 

  IHC staining of human lymphoma using 11760-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 11760-1-AP (HNRNPC antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of mouse colon using 11760-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 11760-1-AP (HNRNPC antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 11760-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 11760-1-AP (HNRNPC antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11760-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HNRNPC antibody (11760-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

HNRNPC Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11760-1-AP

Publications(48)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

SNRPC, HNRPC, hnRNP C1/C2, HNRNP, C2

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue, K-562 cells, HepG2 cells, MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse colon tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 35 publications below
• IHC: See 11 publications below
• IF: See 6 publications below
• IP: See 2 publications below
• RIP: See 4 publications below

Product Information

11760-1-AP targets HNRNPC in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2356

  Product name: Recombinant human HNRNPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-293 aa of BC003394

  Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS

• Full Name: heterogeneous nuclear ribonucleoprotein C (C1/C2)
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa, 36-40 kDa
• GenBank Accession Number: BC003394
• Gene Symbol: HNRNPC
• Gene ID (NCBI): 3183
• RRID: AB_2117500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07910
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; METTL3 regulates heterochromatin in mouse embryonic stem cells.; Authors - Wenqi Xu
human	WB	Cell Metab; NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.; Authors - Mi Kyung Park
human	WB	Nat Struct Mol Biol; Alternative polyadenylation by sequential activation of distal and proximal PolyA sites.; Authors - Peng Tang
human	WB	Adv Sci (Weinh); m6A-Modified circTET2 Interacting with HNRNPC Regulates Fatty Acid Oxidation to Promote the Proliferation of Chronic Lymphocytic Leukemia; Authors - Zijuan Wu ; KD Validated
human	WB	Nucleic Acids Res; Sequence-dependent recruitment of SRSF1 and SRSF7 to intronless lncRNA NKILA promotes nuclear export via the TREX/TAP pathway.; Authors - Misbah Khan
human	WB	Clin Transl Med; LncRNA BC promotes lung adenocarcinoma progression by modulating IMPAD1 alternative splicing; Authors - Qi Wen Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Juliette (Verified Customer) (07-09-2025)

Works very well in WB (dilution = 1:10 000), in immunofluorescence and in immunoprecipitation.

• Applications: Western Blot, Immunofluorescence, Immunoprecipitation
• Cell Tissue Type: HeLa, Jurkat, 293T

FH

Tatyana (Verified Customer) (12-04-2023)

Works very well in ICC (nuclear staining) but extra bands in WB

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human / HeLa cells, SH-SY5Y cells

HNRNPC Antibody Western Blot,Immunofluorescence validation (1:1000 dilution) in Human / HeLa cells, SH-SY5Y cells (Cat no:11760-1-AP)