Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, K-562 cells, HepG2 cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse colon tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11760-1-AP targets HNRNPC in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2356 Product name: Recombinant human HNRNPC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC003394 Sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS Predict reactive species |
| Full Name | heterogeneous nuclear ribonucleoprotein C (C1/C2) |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa, 36-40 kDa |
| GenBank Accession Number | BC003394 |
| Gene Symbol | HNRNPC |
| Gene ID (NCBI) | 3183 |
| RRID | AB_2117500 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07910 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HNRNPC, also named as Heterogeneous nuclear ribonucleoproteins C1/C2, is a 306 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and belongs to the RRM HNRPC family. HNRNPC localizes in the nucleus. It binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. HNRNPC may play a role in the early steps of spliceosome assembly and pre-mRNA splicing. HNRNPC can act as a tetramer and is involved in the assembly of 40S hnRNP particles and plays a role with CSDE1 in internal initiation of translation during mitosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| IHC protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| IP protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| WB protocol for HNRNPC antibody 11760-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-HNRNPC Affinity Purified Antibody (Cat# 11760-1-AP) has 67 citations across journals including Nature, Cell, Cell Metabolism, Nature Microbiology, Nature Communications, Molecular Cell, Science Advances, Cell Death & Disease, and Nucleic Acids Research. Research fields span m6A RNA methylation, cancer biology (lung, liver, breast, glioma, colorectal, ovarian), RNA splicing, neurodegeneration (ALS, Alzheimer's), cardiovascular disease, and metabolic disorders.
| Species | Application | Title |
|---|---|---|
Cell MYC binding to nascent RNA suppresses innate immune signaling by R-loop-derived RNA-DNA hybrids | ||
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. | ||
Nat Microbiol Mapping in-cell protein contact sites reveals hijacking of paraspeckles during influenza A virus infection. | ||
Reviews
What customers say
Both reviewers gave 5-star ratings. One user reported excellent performance in Western blot (at 1:10,000 dilution), immunofluorescence, and immunoprecipitation across HeLa, Jurkat, and 293T cells. The other user found it worked very well for immunocytochemistry with clear nuclear staining on HeLa and SH-SY5Y cells at 1:1,000 dilution, though noted extra bands appeared in Western blot. Overall, the antibody is well-received for its strong signal and versatility across applications, with a minor caveat about WB specificity for one lot.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Juliette (Verified Customer) (07-09-2025) | Works very well in WB (dilution = 1:10 000), in immunofluorescence and in immunoprecipitation.
|
Tatyana (Verified Customer) (12-04-2023) | Works very well in ICC (nuclear staining) but extra bands in WB
![]() |


















