Tested Applications
| Positive WB detected in | HeLa cells, K-562 cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human liver tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10390-1-AP targets HGS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0589 Product name: Recombinant human HGS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 186-387 aa of BC003565 Sequence: GQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPS Predict reactive species |
| Full Name | hepatocyte growth factor-regulated tyrosine kinase substrate |
| Calculated Molecular Weight | 86 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC003565 |
| Gene Symbol | HGS |
| Gene ID (NCBI) | 9146 |
| RRID | AB_2118914 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14964 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS, synonyms: HRS, ZFYVE8) is a 110 to 115-kDa zinc finger phosphotyrosine protein inducible by stimulation with interleukin 2 (IL-2), granulocyte-macrophage colony-stimulating factor (GM-CSF) as well as hepatocyte growth factor (HGF), and is associated with signal-transducing adaptor molecule (STAM). HGS suppresses DNA synthesis upon stimulation with IL-2 and GM-CSF, counteracting STAM's function, which is critical for cell growth signaling mediated by the cytokines. HGS also interacts with the neurofibromatosis 2 tumor suppressor protein Schwannomin/merlin. The growth suppression activity of schwannoma/merlin requires HGS. The binding of schwannoma/merlin to HGS facilitates its ability to function as a tumor suppressor, probably by inhibiting STAT activation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HGS antibody 10390-1-AP | Download protocol |
| IHC protocol for HGS antibody 10390-1-AP | Download protocol |
| IP protocol for HGS antibody 10390-1-AP | Download protocol |
| WB protocol for HGS antibody 10390-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody (Cat# 10390-1-AP) has 22 citations published in journals including Signal Transduction and Targeted Therapy, Cell Research, Nature Communications, Developmental Cell, Current Biology, PLoS Biology, EMBO Reports, iScience, Molecular Biology of the Cell, Autophagy, Journal of Cell Science, and others. Associated research fields span exosome/extracellular vesicle biology, ESCRT-mediated endosomal sorting, cancer, viral replication, immune regulation, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Serine/threonine/tyrosine kinase 1 drives pancreatic carcinogenesis via GSK3β sequestration-mediated Wnt/β-catenin pathway hyperactivation. | ||
Signal Transduct Target Ther The interferon-stimulated exosomal hACE2 potently inhibits SARS-CoV-2 replication through competitively blocking the virus entry.
| ||
Autophagy Dual roles of CXCR4 (C-X-C motif chemokine receptor 4) in promoting entry of ebolavirus and targeting excessive glycoprotein for reticulophagic degradation to facilitate viral fitness | ||
Nat Commun Munc13-4 mediates tumor immune evasion by regulating the sorting and secretion of PD-L1 via exosomes.
| ||
J Pharm Anal Naringenin boosts Parkin-mediated mitophagy via estrogen receptor alpha to maintain mitochondrial quality control and heal diabetic foot ulcer. |
Reviews
What customers say
One reviewer tested this antibody in leukemic T-cells by Western Blot at a 1:1000 dilution and gave it 4 out of 5 stars. They reported consistent detection of the expected 100 kDa band with strong specificity, very low background, and reproducible results across multiple experiments. Overall, the performance was rated as good.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wojciech (Verified Customer) (09-10-2025) | Tested HG5 antibody in T-cells and it consistently detected the expected 100 kDa band with strong specificity and very low background. Results were reproducible across experiments, and overall performance was good.
|
