HDAC7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• HDAC7 Polyclonal antibody (26207-1-AP)

• Featured Product
• KD/KO Validated

HDAC7 Polyclonal Antibody for IP, ELISA

Cat No. 26207-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

HD7, HD7A, HDAC7, HDAC7A, histone deacetylase 7, Histone deacetylase 7A

• 

  IP experiment of K-562 using 26207-1-AP

  IP result of anti-HDAC7 (IP:26207-1-AP, 4ug; Detection:26207-1-AP 1:300) with K-562 cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 26207-1-AP

  IP result of anti-HDAC7 (IP:26207-1-AP, 4ug; Detection:26207-1-AP 1:300) with K-562 cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for HDAC7 in ?

Chat with Able

---

Tested Applications

• Positive IP detected in: K-562 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26207-1-AP targets HDAC7 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24396

  Product name: Recombinant human HDAC7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 447-530 aa of BC006453

  Sequence: EEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL

• Full Name: histone deacetylase 7
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC006453
• Gene Symbol: HDAC7
• Gene ID (NCBI): 51564
• RRID: AB_2880426
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WUI4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The HDAC7 antibody (Cat# 26207-1-AP) has 8 total citations published in journals including J Exp Clin Cancer Res, Cell Death Dis, Int J Biol Sci, Hepatol Commun, Commun Biol, Am J Physiol Cell Physiol, and Cell Biol Int. Research fields span cancer biology (NSCLC, cholangiocarcinoma, ovarian cancer, hepatocellular carcinoma, glioblastoma), protein post-translational modifications (acetylation, ubiquitination), and signaling pathways (β-catenin/FGF18, TGF-β1/Smad3, HDAC7/ENO1), with applications in WB, IP, CoIP, and IHC.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; HDAC7 promotes NSCLC proliferation and metastasis via stabilization by deubiquitinase USP10 and activation of β-catenin-FGF18 pathway.; Authors - Kai Guo ; KD Validated
human	WB	Cell Death Dis; AZGP1 activation by lenvatinib suppresses intrahepatic cholangiocarcinoma epithelial-mesenchymal transition through the TGF-β1/Smad3 pathway; Authors - Liming Deng
human	WB	Int J Biol Sci; Discovery of a novel HDACi structure that inhibits the proliferation of ovarian cancer cells in vivo and in vitro.; Authors - Miao Bai
human,mouse	WB,IHC,CoIP	Int J Biol Sci; DNMT3a promotes LUAD cell proliferation and metastasis by activating the HDAC7 signalling pathway; Authors - Menglong Jiang ; KD Validated
human	IP	Hepatol Commun; ARID1A deficiency promotes malignant proliferation of hepatocellular carcinoma by activating HDAC7/ENO1 signaling pathway.; Authors - Shanshan Zhang
human	WB	Commun Biol; Interplay between acetylation and ubiquitination controls PSAT1 protein stability in lung adenocarcinoma; Authors - Yuhan Liu