HDAC1 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83624-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83624-3-PBS against Human HDAC1 was performed. The affinity constant is below 1 pM.

HDAC1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83624-3-PBS

Clone No.240614D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

EC:3.5.1.-, EC:3.5.1.98, GON 10, HD1, histone deacetylase 1

---

Product Information

83624-3-PBS targets HDAC1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0256

  Product name: Recombinant human HDAC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 184-482 aa of BC000301

  Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

• Full Name: histone deacetylase 1
• Calculated Molecular Weight: 55 kDa
• GenBank Accession Number: BC000301
• Gene Symbol: HDAC1
• Gene ID (NCBI): 3065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13547
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.