GSTP1 Polyclonal antibody

• 

  WB analysis using 15902-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15902-1-AP (GSTP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15902-1-AP

  WB result of GSTP1 antibody (15902-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSTP1 transfected HeLa cells.

• 

  WB analysis of human brain using 15902-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15902-1-AP (GSTP1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 15902-1-AP

  IP result of anti-GSTP1 (IP:15902-1-AP, 3ug; Detection:15902-1-AP 1:800) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human skin using 15902-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15902-1-AP (GSTP1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of mouse skin using 15902-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 15902-1-AP (GSTP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 15902-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 15902-1-AP (GSTP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 15902-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon slide using 15902-1-AP (GSTP1 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 15902-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15902-1-AP (GSTP1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 15902-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15902-1-AP (GSTP1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 15902-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GSTP1 antibody (15902-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  FC experiment of HepG2 using 15902-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug GSTP1 Polyclonal antibody (15902-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

GSTP1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15902-1-AP

Publications(39)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

EC:2.5.1.18, FAEES3, Glutathione S-transferase P, GST3, GST3/GST pi

---

Tested Applications

• Positive WB detected in: COLO 320 cells, human brain tissue, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, PC-3 cells, mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse skin tissue, human colon, human liver tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 29 publications below
• IHC: See 7 publications below
• IF: See 7 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

15902-1-AP targets GSTP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8731

  Product name: Recombinant human GSTP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC010915

  Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Full Name: glutathione S-transferase pi 1
• Calculated Molecular Weight: 210 aa, 23 kDa
• Observed Molecular Weight: 23-28 kDa
• GenBank Accession Number: BC010915
• Gene Symbol: GSTP1
• Gene ID (NCBI): 2950
• RRID: AB_2116216
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09211
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutathione S-transferase Pi (GSTP1) is anisozyme encoded by the GST pi gene that plays an importantregulatory role in detoxification, anti‑oxidative damage, and the occurrence of various diseases (PMID: 14755684). GSTP1 conjugates reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. It is involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PMID:9084911). GSTP1 methylation is frequently associated with tumor development or poor prognosis in a wide range of tumors such as neuroblastoma, hepatocellular carcinoma, endometrial, breast, and prostate cancers (PCa) (PMID: 27594734).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IP	Mol Cell; SMURF2 predisposes cancer cell toward ferroptosis in GPX4-independent manners by promoting GSTP1 degradation; Authors - Wenxin Zhang ; KD Validated
mouse	WB	Redox Biol; GSTP1-mediated S-glutathionylation of Pik3r1 is a redox hub that inhibits osteoclastogenesis through regulating autophagic flux; Authors - Xiaoxiao Ji ; KD Validated
mouse	IF	J Cell Biol; TDP-43 mediates SREBF2-regulated gene expression required for oligodendrocyte myelination.; Authors - Wan Yun Ho
mouse	WB	Part Fibre Toxicol; Protein target identification and toxicological mechanism investigation of silver nanoparticles-induced hepatotoxicity by integrating proteomic and metallomic strategies.; Authors - Ming Xu
mouse	WB	Glia; Developmental maturation and regional heterogeneity but no sexual dimorphism of the murine CNS myelin proteome; Authors - Sophie B Siems
mouse	WB	Cell Death Dis; Poly(ADP-ribosyl)ated PXR is a critical regulator of acetaminophen-induced hepatotoxicity.; Authors - Cheng Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

James (Verified Customer) (11-30-2022)

Works pretty well.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Liver

GSTP1 Antibody Western Blot validation (1/1000 dilution) in Liver (Cat no:15902-1-AP)