Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, PC-3 cells, mouse thymus tissue, rat thymus tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human lung cancer tissue, human prostate hyperplasia tissue, human testis tissue, rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22104-1-AP targets GSK3B in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, bovine, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species |
| Full Name | glycogen synthase kinase 3 beta |
| Calculated Molecular Weight | 433 aa, 48 kDa |
| Observed Molecular Weight | 46-48 kDa |
| GenBank Accession Number | BC000251 |
| Gene Symbol | GSK3B |
| Gene ID (NCBI) | 2932 |
| RRID | AB_2878997 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49841 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase.GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to INS regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution. This antibody recognize the C-terminal of GSK3B.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GSK3B antibody 22104-1-AP | Download protocol |
| IHC protocol for GSK3B antibody 22104-1-AP | Download protocol |
| IP protocol for GSK3B antibody 22104-1-AP | Download protocol |
| WB protocol for GSK3B antibody 22104-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer | ||
Nat Commun F-box protein FBXO32 ubiquitinates and stabilizes D-type cyclins to drive cancer progression | ||
Mol Cancer Hypoxia downregulated miR-4521 suppresses gastric carcinoma progression through regulation of IGF2 and FOXM1. | ||
Cell Rep Med Development of an orally bioavailable CDK12/13 degrader and induction of synthetic lethality with AKT pathway inhibition | ||
Nat Commun Endonuclease G promotes autophagy by suppressing mTOR signaling and activating the DNA damage response. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tom (Verified Customer) (12-15-2020) | HEK293 lysates - 10ug total protein. Blocked in 5% BSA before primary antibody (1:1000) overnight at 4 degrees. Anti-rabbit HRP (1:10,000) for 1 hour at RT.
![]() |




































