GPX4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GPX4 Polyclonal antibody (30388-1-AP)

• Featured Product
• KD/KO Validated

GPX4 Polyclonal Antibody for WB, IF-P, FC (Intra), IP, ELISA

Cat No. 30388-1-AP Copied!

Publications (361)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

EC:1.11.1.12, EC:1.11.1.9, GPx 4, GPx-4, GSHPx 4

• 

  WB analysis using 30388-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30388-1-AP (GPX4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30388-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30388-1-AP (GPX4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 30388-1-AP

  WB result of GPX4 antibody (30388-1-AP; 1:2400; incubated at room temperature for 1.5 hours) with sh-Control and sh-GPX4 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of rat testis using 30388-1-AP

  IP result of anti-GPX4 (IP:30388-1-AP, 4ug; Detection:30388-1-AP 1:3000) with rat testis tissue lysate 1880 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat testis using 30388-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat testis tissue using GPX4 antibody (30388-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat testis using 30388-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat testis tissue using GPX4 antibody (30388-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 30388-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human GPX4 (30388-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GPX4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HL-60 cells, HEK-293 cells, Jurkat cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: rat testis tissue
• Positive IF-P detected in: rat testis tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30388-1-AP targets GPX4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, bovine, sheep, goat, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30650

  Product name: Recombinant human GPX4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 107-197 aa of BC021567

  Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

• Full Name: glutathione peroxidase 4 (phospholipid hydroperoxidase)
• Observed Molecular Weight: 18-23 kDa
• GenBank Accession Number: BC021567
• Gene Symbol: GPX4
• Gene ID (NCBI): 2879
• RRID: AB_3086304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36969
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.

Publications

What published studies show

The GPX4 Polyclonal antibody (Cat# 30388-1-AP) has 361 total citations published in high-impact journals including Nature Communications, Nature Cell Biology, Advanced Materials, Bioactive Materials, Redox Biology, Theranostics, Biomaterials, Science Advances, Cell Death & Differentiation, Free Radical Biology and Medicine, and Phytomedicine. Associated research fields encompass ferroptosis mechanisms, cancer nanomedicine, neuroprotection, cardiovascular and renal injury, oxidative stress, drug resistance, and inflammatory diseases, with predominant applications in Western blot, immunohistochemistry, and immunofluorescence.

Automatically generated from the 361 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Mater; Eliminating Radioresistance With a Magnetic Ion-Generator by Simultaneously Augmenting DNA Damage and Diminishing Immunosuppression; Authors - Ruru Zhang
mouse	WB,IF	Adv Mater; NIR-Actuated Ferroptosis Nanomotor for Enhanced Tumor Penetration and Therapy; Authors - Ziwei Hu
rat,mouse	WB,IHC,IF	Bioact Mater; A two-pronged approach to inhibit ferroptosis of MSCs caused by the iron overload in postmenopausal osteoporosis and promote osseointegration of titanium implant; Authors - Yulu Yang
mouse	WB,IHC,IF	Bioact Mater; Fe(3+)-based nanovesicle mediated transferrin hijacking for glioblastoma stem cell tumoricidal treatment and postoperative recurrence inhibition.; Authors - Fuming Liang
human	WB	Bioact Mater; ADGRG1-targeted hypoxia preconditioned extracellular vesicles ameliorate intervertebral disc degeneration by delivering taurine to disrupt the oxidative stress feedback loop-driven ferroptosis in nucleus pulposus cells.; Authors - Shang Chen
human	WB,IHC	Bioact Mater; Regulating SLC7A11/GSH/GPX4 axis by glucose dyshomeostasis to simultaneously promote disulfidptosis, cuproptosis and ferroptosis.; Authors - Mengsi Zhang