GNAQ Monoclonal antibody, PBS Only

• 

  WB analysis using 68191-1-Ig (same clone as 68191-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68191-1-Ig (GNAQ antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 68191-1-Ig (same clone as 68191-1-PBS)

  WB result of GNAQ antibody (68191-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GNAQ transfected MCF-7 cells. This data was developed using the same antibody clone with 68191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig cerebellum using 68191-1-Ig (same clone as 68191-1-PBS)

  pig cerebellum tissue were subjected to SDS PAGE followed by western blot with 68191-1-Ig (GNAQ antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68191-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68191-1-Ig (same clone as 68191-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68191-1-Ig (GNAQ antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat cerebellum using 68191-1-Ig (same clone as 68191-1-PBS)

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 68191-1-Ig (GNAQ antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 68191-1-Ig (same clone as 68191-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 68191-1-Ig (GNAQ antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68191-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GNAQ Monoclonal Antibody for WB, ELISA

Cat No. 68191-1-PBS

Clone No.2H5G6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, ELISA

Synonyms

2H5G6, CMC1, G ALPHA q, GAQ, Guanine nucleotide-binding protein alpha-q

---

Product Information

68191-1-PBS targets GNAQ in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26178

  Product name: Recombinant human GNAQ protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 84-205 aa of BC057777

  Sequence: FTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVD

• Full Name: guanine nucleotide binding protein (G protein), q polypeptide
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC057777
• Gene Symbol: GNAQ
• Gene ID (NCBI): 2776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50148
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GNAQ is a proto-oncogene closely related to the α subunit of guanine nucleotide-binding proteins (G proteins) that serve as key intermediates between membrane-bound G-protein-coupled receptors (GPCRs) and GPCR signalling nodes. Aberrant expression and activity of G proteins and GPCRs are frequently associated with tumorigenesis. Recent studies show that oncogenic activating mutations in GNAQ are present in 80% of the melanomas. The calculated molecular weight of GNAQ is 42 kDa. This antibody can detect a band of 38-40 kDa in SDS-PAGE. (PMID: 33993733)