GLUT4 Polyclonal antibody

GLUT4 Polyclonal Antibody for IHC, ELISA
Cat No. 21048-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

IHC, IF, ELISA

GLUT 4, GLUT4, SLC2A4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse adipose tissue, mouse brain tissue, rat brain tissue
Positive IHC detected inmouse skeletal muscle tissue, mouse cerebellum tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:500
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21048-1-AP targets GLUT4 in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, lasiopodomys brandtii
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15390

Product name: Recombinant human GLUT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 228-292 aa of BC069615

Sequence: RYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAV

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 4
Calculated Molecular Weight 509 aa, 55 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC069615
Gene Symbol GLUT4
Gene ID (NCBI) 6517
RRIDAB_2878802
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14672
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucose transporter 4 (GLUT4), also known as solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4), is a transporter protein regulating glucose transport across cell membranes in an insulin-dependent manner.

What is the molecular weight of GLUT4? Is GLUT4 post-translationally modified?

The molecular weight of GLUT4 transporter is 55 kDa. GLUT4 can be N-glycosylated, which is important for its stability and trafficking between the recycling compartment and plasma membrane (PMID: 21757715 and 22545627), and it can also be ubiquitinated and phosphorylated (PMID: 23665900).

What is the subcellular localization of GLUT4?

Glucose transporters, including GLUT4, are multiple-pass integral membrane proteins. GLUT4 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes. The localization of GLUT4 depends on stimulation with insulin - in basal conditions GLUT4 is retained intracellularly, while upon insulin stimulation it is translocated to the plasma membrane (PMID: 18570632).

What molecules can be transported by GLUT4?

Although the main substrate of GLUT4 transport is glucose, it can also transport glucosamine.

What is the tissue expression pattern of GLUT4?

GLUT4 is expressed in white and brown adipose tissue and in muscle and heart cells, where it is the main glucose transporter responsible for peripheral glucose uptake in response to insulin.

Which cell lines can be used to study insulin-dependent GLUT4 protein translocation in glucose uptake assays?

Fat and muscle cells are primarily used in glucose uptake assays because they physiologically respond to insulin (PMID: 26646194). The most commonly used cell lines are 3T3-L1 cells (murine pre-adipose fibroblasts), L6 cells (rat myoblasts), and C2C12 cells (murine myoblasts).



Protocols

Product Specific Protocols
IHC protocol for GLUT4 antibody 21048-1-APDownload protocol
WB protocol for GLUT4 antibody 21048-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

Biomed Pharmacother

Qing brick tea (QBT) aqueous extract protects monosodium glutamate-induced obese mice against metabolic syndrome and involves up-regulation Transcription Factor Nuclear Factor-Erythroid 2-Related Factor 2 (Nrf2) antioxidant pathway.

Authors - Wenqi Gao
humanIHC

J Hematol Oncol

The PIK3CA E542K and E545K mutations promote glycolysis and proliferation via induction of the β-catenin/SIRT3 signaling pathway in cervical cancer.

Authors - Wei Jiang
mouseIF

Development

LONP1-mediated mitochondrial quality control safeguards metabolic shifts in heart development.

Authors - Ke Zhao
rat

Cell Physiol Biochem

PGC-1α Participates in the Protective Effect of Chronic Intermittent Hypobaric Hypoxia on Cardiomyocytes.

Authors - Shuo Gu
rat

Food Chem Toxicol

3-Chloro-1, 2-propanediol inhibits autophagic flux by impairment of lysosomal function in HepG2 cells.

Authors - Jing Lu
mouse

J Cell Mol Med

FGF19 protects skeletal muscle against obesity-induced muscle atrophy, metabolic derangement and abnormal irisin levels via the AMPK/SIRT-1/PGC-α pathway.

Authors - Ai Guo
Loading...
||
New chat Able
正在加载,请稍候...