Tested Applications
| Positive WB detected in | mouse brain tissue, mouse testis tissue, mouse heart tissue, rat brain tissue, rat heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | rat heart tissue, mouse heart tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue, human heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:3000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26980-1-AP targets Connexin 43 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25533 Product name: Recombinant human Connexin 43 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 232-382 aa of BC026329 Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Predict reactive species |
| Full Name | gap junction protein, alpha 1, 43kDa |
| Calculated Molecular Weight | 43 kDa |
| Observed Molecular Weight | 43-47 kDa |
| GenBank Accession Number | BC026329 |
| Gene Symbol | Connexin-43 |
| Gene ID (NCBI) | 2697 |
| RRID | AB_2880711 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17302 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Connexin-43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Cx43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Connexin 43 antibody 26980-1-AP | Download protocol |
| IHC protocol for Connexin 43 antibody 26980-1-AP | Download protocol |
| IP protocol for Connexin 43 antibody 26980-1-AP | Download protocol |
| WB protocol for Connexin 43 antibody 26980-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Connexin 43 antibody (Cat# 26980-1-AP) has accumulated 117 citations published in journals including Nature Communications, Nature Nanotechnology, Immunity, Nature Aging, Science Advances, Advanced Science, Free Radical Biology and Medicine, FASEB Journal, Stem Cells, and Phytomedicine. Associated research fields span cardiovascular disease (atrial fibrillation, myocardial infarction), reproductive biology (blood-testis barrier, spermatogenesis), neuroscience (spinal cord injury, neurodegeneration), oncology, immunology, toxicology, and gap junction-mediated cell-cell communication.
| Species | Application | Title |
|---|---|---|
Eur Heart J Left bundle branch vs biventricular pacing: mechanistic insights from a canine model. | ||
Nat Nanotechnol Oral mitochondrial transplantation using nanomotors to treat ischaemic heart disease. | ||
Immunity OAS cross-activates RNase L intercellularly through cell-to-cell transfer of 2-5A to spread innate immunity | ||
Nat Aging Mevalonate metabolites boost aged oocyte quality through prenylation of small GTPases. | ||
J Extracell Vesicles Umbilical Cord-Mesenchymal Stromal Cell-Derived Extracellular Vesicles Target the Liver to Improve Neurovascular Health in Type 2 Diabetes With Non-Alcoholic Fatty Liver Disease | ||
Nat Commun Targeting APLN/APJ restores blood-testis barrier and improves spermatogenesis in murine and human diabetic models |
Reviews
What customers say
All three reviews rate this antibody 5 stars. Users report excellent performance across Western Blot and Immunofluorescence applications. One reviewer confirmed it works well in HUVEC cells, while another noted it detected the target protein at the correct molecular weight with no background signal in BEND.3 cells at a 1:1000 dilution. A third user successfully applied it for immunofluorescence on mouse brain slices. Overall, customers are highly satisfied with its specificity, sensitivity, and lack of background noise.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sama (Verified Customer) (03-26-2026) |
![]() |
Muhammad (Verified Customer) (08-30-2022) | Cx43 antibody used is excellent and working in HUVEC cells.
|
ABDULLAH (Verified Customer) (11-08-2019) | This antibody worked great!It detected the protein at the right size.There wasn't any background.
|
























