GGCX Polyclonal antibody

• 

  WB analysis of MCF-7 using 16209-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16209-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16209-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 16209-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 16209-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 16209-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16209-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 16209-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16209-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 16209-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 16209-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 16209-1-AP (GGCX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 16209-1-AP

  IP result of anti-GGCX (IP:16209-1-AP, 4ug; Detection:16209-1-AP 1:2000) with mouse liver tissue lysate 4000ug.

• 

  IHC staining of human liver using 16209-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 16209-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver using 16209-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 16209-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human brain using 16209-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 16209-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16209-1-AP (GGCX antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

GGCX Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 16209-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

gamma glutamyl carboxylase, GC, GGCX, VKCFD1

---

Tested Applications

• Positive WB detected in: MCF7 cells, HEK-293 cells, HepG2 cells, L02 cells, MCF-7 cells, mouse liver tissue, PC-3 cells
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 9 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 2 publications below

Product Information

16209-1-AP targets GGCX in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9185

  Product name: Recombinant human GGCX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 383-758 aa of BC013979

  Sequence: LTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF

• Full Name: gamma-glutamyl carboxylase
• Calculated Molecular Weight: 758 aa, 88 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC013979
• Gene Symbol: GGCX
• Gene ID (NCBI): 2677
• RRID: AB_2110874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38435
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GGCX(Gamma-glutamyl carboxylase) is also named as GC and belongs to the vitamin K-dependent gamma-carboxylase family. This 94 kDa (including all modifications, such as the five N-linked glycosylations), is a 5-pass transmembrane protein and a key regulator of blood coagulation(PMID:20518534). It mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. Defects in GGCX are a cause of combined deficiency of vitamin K-dependent clotting factors type 1 (VKCFD1) and pseudoxanthoma elasticum-like disorder with multiple coagulation factor deficiency (PXEL-MCFD)(PMID:9845520;17110937).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cell Biol; GGCX and VKORC1 inhibit osteocalcin endocrine functions.; Authors - Mathieu Ferron
		Blood; Characterization of vitamin K-dependent carboxylase mutations that cause bleeding and nonbleeding disorders.; Authors - Jian-Ke Tie
human	WB	Methods Enzymol; Functional Study of the Vitamin K Cycle Enzymes in Live Cells.; Authors - J-K Tie ; KO Validated
human	WB	JCI Insight; VKOR paralog VKORC1L1 supports vitamin K-dependent protein carboxylation in vivo.; Authors - Julie Lacombe
human	WB	Oncotarget; Divergent effects of vitamins K1 and K2 on triple negative breast cancer cells.; Authors - Sarah Beaudin
human,mouse	WB,IP	Cell Rep; Vitamin K-dependent carboxylation regulates Ca2+ flux and adaptation to metabolic stress in β cells; Authors - Julie Lacombe