Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, human liver tissue, mouse brain tissue, mouse kidney tissue |
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human ovary cancer tissue, human kidney tissue, human liver tissue, human ovary tissue, human skin tissue, rat ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 13 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
16726-1-AP targets GCSH in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10174 Product name: Recombinant human GCSH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC000790 Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE Predict reactive species |
| Full Name | glycine cleavage system protein H (aminomethyl carrier) |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC000790 |
| Gene Symbol | GCSH |
| Gene ID (NCBI) | 2653 |
| RRID | AB_2247351 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23434 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GCSH(Glycine cleavage system H protein, mitochondrial) is a component of the glycine cleavage system loosely associated with the mitochondrial inner membrane and has lipoic acid as a prosthetic group. The full-length GCSH cDNA encodes a precursor protein of 173 amino acids and a mature protein of 125 amino acids. The lipoylation of H-protein occurs in mitochondria which probably contain an activated form of lipoic acid as well as other components required for the transfer of lipoic acid to the protein(PMID:2211640). Defects in GCSH are a cause of non-ketotic hyperglycinemia (NKH).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GCSH antibody 16726-1-AP | Download protocol |
| IHC protocol for GCSH antibody 16726-1-AP | Download protocol |
| IP protocol for GCSH antibody 16726-1-AP | Download protocol |
| WB protocol for GCSH antibody 16726-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Blocking glycine utilization inhibits multiple myeloma progression by disrupting glutathione balance.
| ||
J Biol Chem Acute loss of iron-sulfur clusters results in metabolic reprogramming and generation of lipid droplets in mammalian cells. | ||
PLoS One Amino Acid starvation has opposite effects on mitochondrial and cytosolic protein synthesis. |







































