Tested Applications
| Positive WB detected in | DU 145 cells, HEK-293T cells, HepG2 cells, SGC-7901 cells, mouse brain tissue, rat brain tissue, mouse kidney tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Daudi cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18592-1-AP targets FOXO1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13296 Product name: Recombinant human FOXO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-655 aa of BC021981 Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG Predict reactive species |
| Full Name | forkhead box O1 |
| Calculated Molecular Weight | 655 aa, 70 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC021981 |
| Gene Symbol | FOXO1 |
| Gene ID (NCBI) | 2308 |
| RRID | AB_10860103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12778 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| IF protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| IHC protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| IP protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| WB protocol for FOXO1 antibody 18592-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-FOXO1 antibody (Cat# 18592-1-AP) has accumulated 253 citations across high-impact journals including Cell, Nature Communications, Nature Metabolism, Nature Aging, PNAS, Redox Biology, Advanced Science, Biomaterials, and Autophagy. Research fields span metabolic regulation (glucose/lipid homeostasis), oncology, cardiovascular disease, neurodegeneration, aging/senescence, diabetes, bone metabolism, reproductive biology, oxidative stress, autophagy, ferroptosis, and toxicology.
| Species | Application | Title |
|---|---|---|
Cell Res Blocking FSH inhibits hepatic cholesterol biosynthesis and reduces serum cholesterol. | ||
Nat Metab Proline exacerbates hepatic gluconeogenesis via paraspeckle-dependent mRNA retention | ||
Nat Aging Senescent macrophages induce ferroptosis in skeletal muscle and accelerate osteoarthritis-related muscle atrophy | ||
Nat Aging A metabolic atlas of blood cells in young and aged mice identifies uridine as a metabolite to rejuvenate aged hematopoietic stem cells | ||
Clin Mol Hepatol MET promotes hepatocellular carcinoma development through the promotion of TRIB3-mediated FOXO1 degradation
|
Reviews
What customers say
Users consistently rate this FOXO1 antibody highly for Western blot, with three reviewers using it at 1:1000–1:4000 dilution and reporting specific bands around 20 KDa in liver tissue and HepG2 cells. One user also validated it for immunofluorescence on mouse skin using a free sample and expressed satisfaction with the results. Overall, reviewers describe it as a reliable and specific reagent suitable for both WB and IF applications across multiple species and cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (08-19-2026) | FOXO1 is very good antibody
|
MALLIKARJUNA (Verified Customer) (11-07-2025) | GOOD FOR WESTERN
|
Hala (Verified Customer) (01-27-2023) | an specific band is observed around 20 KDa
 |
Ruchi (Verified Customer) (07-08-2022) | I used the free sample antibody for immunofluorescence and I am happy with the results. I would like to order Proteintech products for my lab needs
 |
