FOXC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FOXC1 Polyclonal antibody (30082-1-AP)

FOXC1 Polyclonal Antibody for WB, ELISA

Cat No. 30082-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FREAC3, FREAC 3, Forkhead-related transcription factor 3, Forkhead-related protein FKHL7, FKHL7

• 

  WB analysis using 30082-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30082-1-AP (FOXC1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FOXC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30082-1-AP targets FOXC1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32531

  Product name: Recombinant human FOXC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 404-553 aa of NM_001453.3

  Sequence: AAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF

• Full Name: forkhead box C1
• Calculated Molecular Weight: 57kd
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001453.3
• Gene Symbol: FOXC1
• Gene ID (NCBI): 2296
• RRID: AB_2935512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12948
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXC1, also named as FKHL7 and FREAC3, binding of FREAC-3 and FREAC-4 to their cognate sites results in bending of the DNA at an angle of 80-90 degrees. Defects in FOXC1 are the cause of Axenfeld-Rieger syndrome type 3 (RIEG3). Defects in FOXC1 are the cause of iridogoniodysgenesis anomaly (IGDA). Defects in FOXC1 are a cause of Peters anomaly. This antibody is specific to FOXC1. Phosphorylation modification of Foxc1 protein may be responsible for the larger molecular weight of detection compared with theoretical molecular weight (PMID:27708239;16403239).

Publications

What published studies show

FOXC1 Polyclonal antibody (Cat# 30082-1-AP) has 2 total citations. The citations appear in International Journal of Molecular Sciences and Molecular Cell. The associated research fields include ocular biology (limbal epithelial cell homeostasis and cytokine/inflammatory signaling) and molecular genetics (cohesin-mediated transcriptional regulation via Cdk9/RNAPol2 activation). Both studies utilized the antibody for Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; FOXC1 Regulates Cytokine Signaling, Inflammatory Pathways, and Retinoid Metabolism to Maintain Limbal Epithelial Cell Homeostasis In Vitro.; Authors - Swarnali Kundu ; KD Validated
human	WB	Mol Cell; Cohesin preservation across mitosis contributes to restart transcription via Cdk9-mediated activation of RNAPol2.; Authors - Aida Contreras-Pérez