• Featured Product
  • KD/KO Validated

c-Fos Polyclonal antibody

c-Fos Polyclonal Antibody for WB, IF, IHC, ELISA
Cat No. 26192-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, ELISA

AP 1, C FOS, Cellular oncogene fos, c-Fos, FOS, G0S7, Proto oncogene c Fos

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRAW 264.7 cells
Positive IHC detected inmouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26192-1-AP targets c-Fos in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24340

Product name: Recombinant human FOS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 196-341 aa of BC004490

Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF

Predict reactive species
Full Name FOS
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC004490
Gene Symbol c-Fos
Gene ID (NCBI) 2353
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01100
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

c-Fos, also named as FOS and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. c-Fos is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, c-Fos undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the c-Fos protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the c-FOS protein becomes nuclear. c-Fos is a very short-lived intracellular protein, which is very easy to degrade. The calculated molecular weight of c-Fos is 40 kDa, but Phosphorylated c-Fos protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-Fos is an indirect marker of neuronal activity because c-Fos is often expressed when neurons fire action potentials. Upregulation of c-Fos mRNA in a neuron indicates recent activity.

Publications

SpeciesApplicationTitle
mouseIHC, IF

Nature

Mechanisms of stretch-mediated skin expansion at single-cell resolution.

Authors - Mariaceleste Aragona
mouseWB

Neuron

Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.

Authors - Xiaohui Li
IF

Sci Adv

GPR39 regulated spinal glycinergic inhibition and mechanical inflammatory pain

Authors - Hu-Hu Bai
mouseIHC

Nat Commun

Ketamine activates adult-born immature granule neurons to rapidly alleviate depression-like behaviors in mice.

Authors - Radhika Rawat
mouseIHC

Biol Psychiatry

Fighting Females: Neural and Behavioral Consequences of Social Defeat Stress in Female Mice.

Authors - Emily L Newman
mouseIHC

Nat Commun

Activating newborn neurons suppresses depression and anxiety-like behaviors.

Authors - Elif Tunc-Ozcan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Matthias (Verified Customer) (09-10-2019)

Good Antibody, very specific.

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 2000
  • Cell Tissue Type: Brain tissue
c-Fos Antibody Immunohistochemistry,Immunofluorescence, validation (2000 dilution) in Brain tissue (Cat no:26192-1-AP)
FH

Elif (Verified Customer) (06-21-2019)

It works better with 2 overnight incubation in 4 degrees.

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Dentate gyrus
c-Fos Antibody Immunohistochemistry, validation (1:500 dilution) in Dentate gyrus (Cat no:26192-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...