FOLR1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 60307-1-Ig (same clone as 60307-1-PBS)

  WB result of FOLR1 antibody (60307-1-Ig, 1:4000) with si-Control and si-FOLR1 transfected HeLa cells.. This data was developed using the same antibody clone with 60307-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human milk using 60307-1-Ig (same clone as 60307-1-PBS)

  human milk were subjected to SDS PAGE followed by western blot with 60307-1-Ig (FOLR1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60307-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60307-1-Ig (same clone as 60307-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60307-1-Ig (FOLR1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 60307-1-Ig (same clone as 60307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60307-1-Ig (FOLR1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 60307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 60307-1-Ig (same clone as 60307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60307-1-Ig (FOLR1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 60307-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FOLR1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60307-1-PBS

Clone No.2B4B7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

2B4B7, Adult folate binding protein, Adult folate-binding protein, FBP, Folate receptor 1

---

Product Information

60307-1-PBS targets FOLR1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19959

  Product name: Recombinant human FOLR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 55-93 aa of BC002947

  Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA

• Full Name: folate receptor 1 (adult)
• Calculated Molecular Weight: 257 aa, 30 kDa
• Observed Molecular Weight: 36-38 kDa
• GenBank Accession Number: BC002947
• Gene Symbol: FOLR1
• Gene ID (NCBI): 2348
• RRID: AB_2881421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15328
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).