• Featured Product
  • KD/KO Validated

FOLR1 Monoclonal antibody, PBS Only

FOLR1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 60307-1-PBS
Clone No.2B4B7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

2B4B7, Adult folate binding protein, Adult folate-binding protein, FBP, Folate receptor 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60307-1-PBS targets FOLR1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19959

Product name: Recombinant human FOLR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 55-93 aa of BC002947

Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA

Predict reactive species
Full Name folate receptor 1 (adult)
Calculated Molecular Weight 257 aa, 30 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC002947
Gene Symbol FOLR1
Gene ID (NCBI) 2348
RRIDAB_2881421
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP15328
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463).

Loading...
||
New chat Able
正在加载,请稍候...