Tested Applications
| Positive WB detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10939-1-AP targets FGF-7/KGF in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1372 Product name: Recombinant human FGF7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC010956 Sequence: MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGEDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYSK Predict reactive species |
| Full Name | fibroblast growth factor 7 (keratinocyte growth factor) |
| Calculated Molecular Weight | 22-28 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC010956 |
| Gene Symbol | FGF7 |
| Gene ID (NCBI) | 2252 |
| RRID | AB_2102816 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21781 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fibroblast growth factor 7 (FGF7), also called keratinocyte growth factor, is a member of the FGF superfamily, which has been reported to stimulate cell proliferation, differentiation, migration, and vascular angiogenesis. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FGF-7/KGF antibody 10939-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

