FGF10 Polyclonal antibody

• 

  WB analysis using 29749-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29749-1-AP (FGF10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse brain using 29749-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using FGF10 antibody (29749-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

FGF10 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 29749-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IF-P, ELISA

Synonyms

FGF 10, FGF10, fibroblast growth factor 10, Keratinocyte growth factor 2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, NIH/3T3 cells
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

29749-1-AP targets FGF10 in WB, IF-P, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31278

  Product name: Recombinant human FGF10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-150 aa of BC105021

  Sequence: QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDC

• Full Name: fibroblast growth factor 10
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC105021
• Gene Symbol: FGF10
• Gene ID (NCBI): 2255
• RRID: AB_2918343
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15520
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FGF10 belongs to the FGF7 subfamily. FGF10 is a paracrine signaling growth factor of 215 amino acids with a typical signal sequence for secretion and plays an essential role during development and tissue homeostasis in adults (PMID: 30405705). FGF10 is mainly produced by neuron and microglia/macrophages (PMID: 28981091). The calculated molecular weight of FGF10 is 23 kDa. Sometimes higher molecular weight around 40 kDa can also be observed, which may be a modified variant of FGF10.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Invest Ophthalmol Vis Sci; KGF-2 Alleviates Dry Eye Disease by Regulating the HMGB1/TLR4 Pathway; Authors - Yuzhou Wang