Fibulin-7 Polyclonal antibody

• 

  WB analysis of pig cartilage using 21136-1-AP

  pig cartilage tissue was subjected to SDS PAGE followed by western blot with 21136-1-AP (Fibulin-7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

Fibulin-7 Polyclonal Antibody for WB, ELISA

Cat No. 21136-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, ELISA

Synonyms

FBLN7, FIBL 7, fibulin 7, TM14

---

Tested Applications

• Positive WB detected in: pig cartilage tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21136-1-AP targets Fibulin-7 in WB, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15564

  Product name: Recombinant human FBLN7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-439 aa of BC035784

  Sequence: GRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF

• Full Name: fibulin 7
• Calculated Molecular Weight: 439 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC035784
• Gene Symbol: Fibulin-7
• Gene ID (NCBI): 129804
• RRID: AB_3085638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q53RD9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibulins are a family of extracellular matrix glycoproteins associated with basement membranes, elastic fibers, and other matrices (PMID: 19189051). The family members are defined by the presence of two structural modules, a tandem repeat of epidermal growth factor-like modules, and a unique C-terminal fibulin-type module (PMID: 19189051). They play an important role in regulating multiple cellular functions such as adhesion, growth, motility, and survival (PMID: 32429873). Fibulin-7, also named as TM14, was first identified in the mouse tooth germ cDNA microarray by differential hybridization (PMID: 17699513). Fibulin-7 is expressed in developing odontoblasts, in the giant trophoblast layer of the placenta, in the choroid of the eyes as well as in the cartilage (PMID: 32429873). It plays important roles in both the differentiation and maintenance of odontoblasts as well as in dentin formation.