Tested Applications
| Positive WB detected in | L02 cells, HeLa cells, Jurkat cells, mouse liver tissue |
| Positive IHC detected in | human colon cancer tissue, human colorectal cancer tissue, human endometrial cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10627-1-AP targets FADS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0978 Product name: Recombinant human FADS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 174-444 aa of BC007846 Sequence: AGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPSALLPLYFQWYIFYFVIQRKKWVDLAWMITFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDAYLHQ Predict reactive species |
| Full Name | fatty acid desaturase 1 |
| Calculated Molecular Weight | 52 kDa, 42 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC007846 |
| Gene Symbol | FADS1 |
| Gene ID (NCBI) | 3992 |
| RRID | AB_2231403 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60427 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FADS1, also known as Delta-5 desaturase or D5D, is a 444 amino acid protein that belongs to the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS1 is a key enzyme in polyunsaturated fatty acid (PUFA) metabolism that catalyze the conversion of linoleic acid (LA) into arachidonic acid (AA) and that of alpha-linolenic acid (ALA) into eicosapentaenoic acid (EPA). FADS1 has two isform: 42 kDa, 52 kDa. FADS1 undergoes multiple post-translational modifications, including ubiquitination, phosphorylation, and glycation, which may alter its molecular weight to 55-60 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FADS1 antibody 10627-1-AP | Download protocol |
| IHC protocol for FADS1 antibody 10627-1-AP | Download protocol |
| WB protocol for FADS1 antibody 10627-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-FADS1 antibody (Cat# 10627-1-AP) has 23 citations across journals including Nature Communications, Cell Metabolism, Science Advances, PNAS, Advanced Science, and Cancer Letters. Research fields span lipid metabolism, ferroptosis, cancer biology (breast, gastric, lung, bladder, colorectal, laryngeal), neuroinflammation, psoriasis, wound healing, and animal nutrition. Applications are predominantly WB, with some IHC and IF.
| Species | Application | Title |
|---|---|---|
Cell Metab STING orchestrates the crosstalk between polyunsaturated fatty acid metabolism and inflammatory responses. | ||
Nat Commun Prosaposin maintains lipid homeostasis in dopamine neurons and counteracts experimental parkinsonism in rodents | ||
Nat Commun The lipoprotein-associated phospholipase A2 inhibitor Darapladib sensitises cancer cells to ferroptosis by remodelling lipid metabolism | ||
Nat Commun The p97-UBXD8 complex regulates ER-Mitochondria contact sites by altering membrane lipid saturation and composition | ||
Adv Sci (Weinh) Reprogramming of Fatty Acid Metabolism via PPARα-Orchestrated FADS2 in Keratinocytes Modulates Skin Inflammation in Psoriasis. |
Reviews
What customers say
Most users report positive experiences with this REDD1 antibody for Western Blot at 1:1000 dilution. Three of four reviewers rated it 5 stars, highlighting specific band detection, reliable and consistent results across repeat experiments, and correct molecular weight in melanoma and cancer cell lines. One reviewer (2 stars) noted the band was unclear and suggested increasing antibody amount. Overall, the antibody is well-regarded for WB applications, with minor variability depending on cell line expression levels and optimization.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jelan (Verified Customer) (01-14-2026) | The REDD1 antibody from Proteintech is a useful, well-validated reagent that generally produces specific bands in Western blots and works reliably when properly optimized. As with any antibody, we confirm specificity with appropriate controls and titrate conditions for your particular assay to ensure the best results.
|
Kristen (Verified Customer) (12-15-2025) | Used to evaluate protein expression of FADS1 in syngeneic mouse melanoma cell lines. Variable expression levels, but correct band size seen in some lines
|
Casey (Verified Customer) (12-02-2025) | Band was not clear. May need to add more antibody.
|
Haley (Verified Customer) (12-01-2025) | Consistently reliable with repeat experiments
|
