Tested Applications
| Positive WB detected in | L02 cells, HeLa cells, Jurkat cells, mouse liver tissue |
| Positive IHC detected in | human colon cancer tissue, human lung cancer tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 15 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
10627-1-AP targets FADS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0978 Product name: Recombinant human FADS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 174-444 aa of BC007846 Sequence: AGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPSALLPLYFQWYIFYFVIQRKKWVDLAWMITFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDAYLHQ Predict reactive species |
| Full Name | fatty acid desaturase 1 |
| Calculated Molecular Weight | 52 kDa, 42 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC007846 |
| Gene Symbol | FADS1 |
| Gene ID (NCBI) | 3992 |
| RRID | AB_2231403 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60427 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FADS1, also known as Delta-5 desaturase or D5D, is a 444 amino acid protein that belongs to the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS1 is a key enzyme in polyunsaturated fatty acid (PUFA) metabolism that catalyze the conversion of linoleic acid (LA) into arachidonic acid (AA) and that of alpha-linolenic acid (ALA) into eicosapentaenoic acid (EPA). FADS1 has two isform: 42 kDa, 52 kDa. FADS1 undergoes multiple post-translational modifications, including ubiquitination, phosphorylation, and glycation, which may alter its molecular weight to 55-60 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FADS1 antibody 10627-1-AP | Download protocol |
| IHC protocol for FADS1 antibody 10627-1-AP | Download protocol |
| WB protocol for FADS1 antibody 10627-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab STING orchestrates the crosstalk between polyunsaturated fatty acid metabolism and inflammatory responses. | ||
Nat Commun The lipoprotein-associated phospholipase A2 inhibitor Darapladib sensitises cancer cells to ferroptosis by remodelling lipid metabolism | ||
Proc Natl Acad Sci U S A Polyunsaturated fatty acid biosynthesis pathway determines ferroptosis sensitivity in gastric cancer. | ||
Stem Cells Increased lipogenesis is critical for self-renewal and growth of breast cancer stem cells: Impact of omega-3 fatty acids. | ||
J Lipid Res In vivo MRS assessment of altered fatty acyl unsaturation in liver tumor formation of a TGF alpha/c-myc transgenic mouse model. | ||
J Cancer Reduced Expression of FADS1 Predicts Worse Prognosis in Non-Small-Cell Lung Cancer. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kristen (Verified Customer) (12-15-2025) | Used to evaluate protein expression of FADS1 in syngeneic mouse melanoma cell lines. Variable expression levels, but correct band size seen in some lines
|
FH Casey (Verified Customer) (12-02-2025) | Band was not clear. May need to add more antibody.
|
FH Haley (Verified Customer) (12-01-2025) | Consistently reliable with repeat experiments
|



















