Tested Applications
| Positive WB detected in | HeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse stomach tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat eye tissue, mouse eye tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 15 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
| RIP | See 1 publications below |
Product Information
26056-1-AP targets Ezrin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species |
| Full Name | ezrin |
| Calculated Molecular Weight | 69 kDa |
| Observed Molecular Weight | 70-80 kDa |
| GenBank Accession Number | BC013903 |
| Gene Symbol | Ezrin |
| Gene ID (NCBI) | 7430 |
| ENSEMBL Gene ID | ENSG00000092820 |
| RRID | AB_2722561 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15311 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ezrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Ezrin antibody 26056-1-AP | Download protocol |
| IHC protocol for Ezrin antibody 26056-1-AP | Download protocol |
| IP protocol for Ezrin antibody 26056-1-AP | Download protocol |
| WB protocol for Ezrin antibody 26056-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Acta Neuropathol Selective vulnerability of tripartite synapses in amyotrophic lateral sclerosis. | ||
Proc Natl Acad Sci U S A Cotranslational interaction of human EBP50 and ezrin overcomes masked binding site during complex assembly.
| ||
Elife Gq activity- and β-arrestin-1 scaffolding-mediated ADGRG2/CFTR coupling are required for male fertility. | ||
J Biol Chem Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. | ||
J Virol Pemetrexed alleviates piglet diarrhea by blocking the interaction between porcine epidemic diarrhea virus nucleocapsid protein and Ezrin |

























