EXOSC10 Monoclonal antibody, PBS Only

• 

  WB analysis using 68315-1-Ig (same clone as 68315-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68315-1-Ig (EXOSC10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 68315-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 68315-1-Ig (same clone as 68315-1-PBS)

  IP result of anti-EXOSC10 (IP:68315-1-Ig, 4ug; Detection:68315-1-Ig 1:1000) with HeLa cells lysate 1720 ug. This data was developed using the same antibody clone with 68315-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68315-1-Ig (same clone as 68315-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EXOSC10 antibody (68315-1-Ig, Clone: 1D6G9 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68315-1-PBS in a different storage buffer formulation.

EXOSC10 Monoclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 68315-1-PBS

Clone No.1D6G9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

1D6G9, EC:3.1.13.-, Exosome complex component 10, P100 polymyositis-scleroderma overlap syndrome-associated autoantigen, PM/Scl-100

---

Product Information

68315-1-PBS targets EXOSC10 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28587

  Product name: Recombinant human EXOSC10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 586-885 aa of BC039901

  Sequence: VAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR

• Full Name: exosome component 10
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC039901
• Gene Symbol: EXOSC10
• Gene ID (NCBI): 5394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q01780
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

About 50% of patients with polymyositis/scleroderma (PM-Scl) overlap syndrome are reported to have autoantibodies to a neuclear/nucleolar particle termed PM-Scl. Exosome component 10 (EXOSC10), also named autoantigen PM/Scl 2, is the 100 kDa antigen component of PM-Scl and is recognized by most sera of PM-Scl paitents. EXOSC10 is strongly enriched in the nucleolus and a small amount has been found in cytoplasm supporting the existence of a nucleolar RNA exosome complex form. As a putative catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity, EXOSC10 participates in a multitude of cellular RNA processing and degradation events.