Tested Applications
| Positive WB detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20793-1-AP targets EVA1B in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14578 Product name: Recombinant human FAM176B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC006241 Sequence: MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVF Predict reactive species |
| Full Name | family with sequence similarity 176, member B |
| Calculated Molecular Weight | 165 aa, 18 kDa |
| Observed Molecular Weight | 25-26 kDa |
| GenBank Accession Number | BC006241 |
| Gene Symbol | FAM176B |
| Gene ID (NCBI) | 55194 |
| RRID | AB_3669348 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NVM1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EVA1B, also known as FAM176B or C1orf78, is a single-pass membrane protein that belongs to the FAM176 family. EVA1B is an important paralog of the EVA1A and is associated with the tumor immune microenvironment and clinical prognosis
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EVA1B antibody 20793-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

