EPRS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EPRS Polyclonal antibody (25307-1-AP)

• Featured Product
• KD/KO Validated

EPRS Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25307-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

EPRS1, Bifunctional aminoacyl-tRNA synthetase, Bifunctional glutamate/proline--tRNA ligase, Cell proliferation-inducing gene 32 protein, EARS

• 

  WB analysis using 25307-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25307-1-AP (EPRS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 25307-1-AP

  WB result of EPRS antibody (25307-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPRS transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 25307-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25307-1-AP (EPRS Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 25307-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using EPRS antibody (25307-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EPRS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25307-1-AP targets EPRS in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18011

  Product name: Recombinant human EPRS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1163-1512 aa of BC126275

  Sequence: RTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYYTLFGRSY

• Full Name: glutamyl-prolyl-tRNA synthetase
• Calculated Molecular Weight: 1512 aa, 171 kDa
• Observed Molecular Weight: 171 kDa
• GenBank Accession Number: BC126275
• Gene Symbol: EPRS
• Gene ID (NCBI): 2058
• RRID: AB_2880023
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07814
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human EPRS is a 172 kDa, 1512 amino acid polypeptide consisting of three major domains. The N and C termini contain ERS and PRS catalytic domains, respectively, joined by a 300 amino acid linker containing three tandem WHEP-TRS (referred to as WHEP) domains. EPRS is a bifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. EPRS has a special role in GAIT-mediated translational control, as it is solely responsible for recognition and interaction with GAIT elements in target mRNAs. (PMID: 29576217, PMID: 22386318, PMID: 19647514)

Publications

What published studies show

The EPRS polyclonal antibody (Cat# 25307-1-AP) has 3 total citations. These appear in Nature Communications, Molecular Cell, and Proteomics. The associated research fields include tRNA aminoacylation and neurodegeneration (ALS/FTD), methyltransferase-independent roles in oncogenic transformation, and exosomal secretion of sugar metabolism regulatory proteins in hepatocellular carcinoma. All citations used the antibody for Western blot in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Phenylalanine-tRNA aminoacylation is compromised by ALS/FTD-associated C9orf72 C4G2 repeat RNA; Authors - Mirjana Malnar Črnigoj
human	WB	Mol Cell; A methyltransferase-independent role for METTL1 in tRNA aminoacylation and oncogenic transformation; Authors - Raja H Ali
human	WB	Proteomics; Motile hepatocellular carcinoma cells preferentially secret sugar metabolism regulatory proteins via exosomes.; Authors - Jing Zhang