EIF3F Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84131-5-RR (same clone as 84131-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84131-5-RR (EIF3F antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84131-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 84131-5-RR (same clone as 84131-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug EIF3F Recombinant antibody (84131-5-RR, Clone:240894A6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84131-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84131-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84131-5-RR against Human EIF3F were performed. The affinity constant is 0.474 nM.

EIF3F Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 84131-5-PBS

Clone No.240894A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

240894A6, eIF3 p47

---

Product Information

84131-5-PBS targets EIF3F in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34849

  Product name: Recombinant human EIF3F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-357 aa of BC000490

  Sequence: SYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

• Full Name: eukaryotic translation initiation factor 3, subunit F
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC000490
• Gene Symbol: EIF3F
• Gene ID (NCBI): 8665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00303
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EIF3F (eukaryotic translation initiation factor 3 subunit F) is a protein that plays an important role in eukaryotic cells and is an integral part of the translation initiation factor 3(Eif3) complex. EIF3 is a complex of at least 10 distinct subunits and is the largest translation initiation factor in eukaryotes.