LC8/DYNLL1 Polyclonal antibody

• 

  WB analysis using 18130-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 18130-1-AP

  IP result of anti-LC8/DYNLL1 (IP:18130-1-AP, 4ug; Detection:18130-1-AP 1:1000) with MCF-7 cells lysate 640 ug.

• 

  IHC staining of human liver using 18130-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 18130-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 18130-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 18130-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18130-1-AP (LC8/DYNLL1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 18130-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using LC8/DYNLL1 antibody (18130-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of Jurkat using 18130-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human LC8/DYNLL1 (18130-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug x. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

LC8/DYNLL1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 18130-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

DYNLL1, Dynein light chain LC8 type 1, DNCLC1, DNCL1, DLC8

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells, mouse brain tissue, mouse cerebellum tissue, mouse testis tissue
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: mouse brain tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

18130-1-AP targets LC8/DYNLL1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12710

  Product name: Recombinant human LC8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC100289

  Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

• Full Name: dynein, light chain, LC8-type 1
• Calculated Molecular Weight: 89 aa, 10 kDa
• Observed Molecular Weight: 8-10 kDa
• GenBank Accession Number: BC100289
• Gene Symbol: DYNLL1
• Gene ID (NCBI): 8655
• RRID: AB_2923569
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63167
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LC8 (also known as DYNLL1) is a homodimeric sequence-specific chaperone that promotes the ordered (typically homo-) oligomerization of more than a hundred protein targets. LC8/DYNLL1 has previously been proposed to function as an inhibitor of the NF-κB pathway, based on findings that it can bind directly to the IκBα regulatory region(PMID: 18579519). LC8/DYNLL1 regulates apoptotic activities of BCL2L11 by sequestering it to microtubules.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Cycle; Tctex1d2 associates with short-rib polydactyly syndrome proteins and is required for ciliogenesis.; Authors - Ankur A Gholkar
mouse	WB	Nanotoxicology; MiR-5622-3p inhibits ZCWPW1 to induce apoptosis in silica-exposed mice and spermatocyte cells; Authors - Moxuan Zhao