Tested Applications
Positive WB detected in | HeLa cells, C6 cells, HEK-293 cells, HepG2 cells, Jurkat cells |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 12 publications below |
WB | See 85 publications below |
IHC | See 5 publications below |
IF | See 10 publications below |
CoIP | See 2 publications below |
ChIP | See 5 publications below |
RIP | See 1 publications below |
Product Information
24206-1-AP targets DNMT1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19116 Product name: Recombinant human DNMT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1288-1632 aa of BC126227 Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD Predict reactive species |
Full Name | DNA (cytosine-5-)-methyltransferase 1 |
Calculated Molecular Weight | 1632 aa, 185 kDa |
Observed Molecular Weight | 180-200 kDa |
GenBank Accession Number | BC126227 |
Gene Symbol | DNMT1 |
Gene ID (NCBI) | 1786 |
RRID | AB_2879457 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P26358 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)
Protocols
Product Specific Protocols | |
---|---|
IF protocol for DNMT1 antibody 24206-1-AP | Download protocol |
IHC protocol for DNMT1 antibody 24206-1-AP | Download protocol |
IP protocol for DNMT1 antibody 24206-1-AP | Download protocol |
WB protocol for DNMT1 antibody 24206-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Environ Int Manganese induces podocyte injury through regulating MTDH/ALKBH5/NLRP10 axis: Combined analysis at epidemiology and molecular biology levels | ||
Cell Death Dis Long noncoding RNA LINC01594 inhibits the CELF6-mediated splicing of oncogenic CD44 variants to promote colorectal cancer metastasis | ||
Chemosphere Cyhexatin causes developmental toxic effects by disrupting endocrine system and inducing behavioral inhibition, apoptosis and DNA hypomethylation in zebrafish (Danio rerio) larvae | ||
Bioact Mater Matrix stiffness exacerbates the proinflammatory responses of vascular smooth muscle cell through the DDR1-DNMT1 mechanotransduction axis.
| ||
Clin Transl Med Melatonin inhibits lipid accumulation to repress prostate cancer progression by mediating the epigenetic modification of CES1. | ||
J Transl Med The role of TET2-mediated ROBO4 hypomethylation in the development of diabetic retinopathy |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Roy (Verified Customer) (09-17-2025) | Great band at the expected size. The dilution used was 1/1000 with an 1h incubation at Room Temperature
|
FH Paula (Verified Customer) (12-14-2021) | good bands at the right molecular weight, but a lot of smear
![]() |