Tested Applications
| Positive WB detected in | HeLa cells, C6 cells, HEK-293 cells, HepG2 cells, Jurkat cells |
| Positive IP detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24206-1-AP targets DNMT1 in WB, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken, zebrafish, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19116 Product name: Recombinant human DNMT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1288-1632 aa of BC126227 Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD Predict reactive species |
| Full Name | DNA (cytosine-5-)-methyltransferase 1 |
| Calculated Molecular Weight | 1632 aa, 185 kDa |
| Observed Molecular Weight | 180-200 kDa |
| GenBank Accession Number | BC126227 |
| Gene Symbol | DNMT1 |
| Gene ID (NCBI) | 1786 |
| RRID | AB_2879457 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P26358 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for DNMT1 antibody 24206-1-AP | Download protocol |
| WB protocol for DNMT1 antibody 24206-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DNMT1 Polyclonal antibody (Cat# 24206-1-AP) has 133 citations. Publications appear in journals including Molecular Cancer, Nature Cancer, Bioactive Materials, Journal of Advanced Research, Redox Biology, Theranostics, Advanced Science, Cell Reports, Cell Death & Disease, Cancer Letters, EMBO Journal, Free Radical Biology & Medicine, and PLoS One. Research fields span epigenetics/DNA methylation, oncology (liver, lung, colorectal, breast, prostate, thyroid cancers), ferroptosis, cardiovascular disease, diabetes, reproductive biology, and neurology.
| Species | Application | Title |
|---|---|---|
Mol Cancer Crosstalk between 5-methylcytosine and N6-methyladenosine machinery defines disease progression, therapeutic response and pharmacogenomic landscape in hepatocellular carcinoma | ||
Bioact Mater Matrix stiffness exacerbates the proinflammatory responses of vascular smooth muscle cell through the DDR1-DNMT1 mechanotransduction axis.
| ||
J Adv Res UHRF1-mediated DNA 5-mC modification drives super-enhancer redistribution and impedes osteogenesis via TGM2-regulated autophagic flux in senile osteoporosis. | ||
Redox Biol DNMT1-DUOXA1 axis discovers a novel methylation-ferroptosis circuit in bicalutamide-resistant prostate cancer.
| ||
Theranostics Targeting CPS1 attenuates lung cancer metastasis by regulating EMT through an epigenetic mechanism. |
Reviews
What customers say
Users report clear bands at the expected molecular weight for Western Blot applications. One reviewer achieved strong results in HeLa cells using a 1/1000 dilution with 1-hour room-temperature incubation, rating the product highly. Another user working with fetal rat lung tissue at 1:500 dilution observed correct-sized bands but noted significant background smear, resulting in a lower rating. Overall, the antibody performs well for WB with appropriate dilution optimization recommended to minimize non-specific signal.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (09-17-2025) | Great band at the expected size. The dilution used was 1/1000 with an 1h incubation at Room Temperature
 |
Paula (Verified Customer) (12-14-2021) | good bands at the right molecular weight, but a lot of smear
 |
