DNAJC2/MPP11 Polyclonal antibody

• 

  WB analysis of K-562 using 11971-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11971-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11971-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 11971-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 11971-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 11971-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11971-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 11971-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11971-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 11971-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 11971-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 11971-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 11971-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 11971-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 11971-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 11971-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 11971-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11971-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 11971-1-AP

  IP result of anti-DNAJC2/MPP11 (IP:11971-1-AP, 4ug; Detection:11971-1-AP 1:1000) with mouse liver tissue lysate 6000ug.

• 

  IHC staining of human liver cancer using 11971-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11971-1-AP (DNAJC2/MPP11 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 11971-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11971-1-AP (DNAJC2/MPP11 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 11971-1-AP

  Immunofluorescent analysis of HepG2 cells, using DNAJC2 antibody 11971-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of HeLa using 11971-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DNAJC2/MPP11 antibody (11971-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

DNAJC2/MPP11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11971-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DNAJC2, DnaJ homolog subfamily C member 2, N-terminally processed, M-phase phosphoprotein 11, MPHOSPH11, MPP11

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells, mouse liver tissue, PC-3 cells
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

11971-1-AP targets DNAJC2/MPP11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2594

  Product name: Recombinant human MPP11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC056682

  Sequence: MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKGSPGDSYQKLILQLIHLMKCYLIQ

• Full Name: DnaJ (Hsp40) homolog, subfamily C, member 2
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 66-75 kDa
• GenBank Accession Number: BC056682
• Gene Symbol: DNAJC2
• Gene ID (NCBI): 27000
• RRID: AB_10695893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99543
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO J; Dual roles of HSP70 chaperone HSPA1 in quality control of nascent and newly synthesized proteins.; Authors - Guiyou Tian
human	WB	Cancers (Basel); Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin; Authors - Mohamed Alalem