DHX58/LGP2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 11355-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11355-1-AP (DHX58/LGP2 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11355-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 11355-1-AP

  IP result of anti-DHX58/LGP2 (IP:11355-1-AP, 3ug; Detection:11355-1-AP 1:300) with mouse liver tissue lysate 6000ug.

• 

  IHC staining of human breast cancer using 11355-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11355-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human nephroblastoma using 11355-1-AP

  Immunohistochemical analysis of paraffin-embedded human nephroblastoma tissue slide using 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human nephroblastoma using 11355-1-AP

  Immunohistochemical analysis of paraffin-embedded human nephroblastoma tissue slide using 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11355-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 11355-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast cancer using 11355-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11355-1-AP (DHX58/LGP2 antibody) at dilution of 1:10 (under 10x lens).

• Featured Product
• KD/KO Validated

DHX58/LGP2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11355-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, CoIP, RIP, ELISA

Synonyms

DHX58, LGP2, ATP-dependent helicase LGP2, ATP-dependent RNA helicase DHX58, D11LGP2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, rat kidney tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human breast cancer tissue, human nephroblastoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 15 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below
• RIP: See 1 publications below

Product Information

11355-1-AP targets DHX58/LGP2 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, monkey, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1910

  Product name: Recombinant human DHX58 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-678 aa of BC014949

  Sequence: LFDDRKNELAHLATHGPENPKLEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD

• Full Name: DEXH (Asp-Glu-X-His) box polypeptide 58
• Calculated Molecular Weight: 678 aa, 77 kDa
• Observed Molecular Weight: 77 kDa
• GenBank Accession Number: BC014949
• Gene Symbol: DHX58
• Gene ID (NCBI): 79132
• RRID: AB_2092319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96C10
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DHX58(Probable ATP-dependent RNA helicase DHX58) is also named as D11LGP2E, LGP2 and belongs to the RLR subfamily. DHX58, originally identified as a highly expressed gene in mammary tumors, is another cytoplasmic DEX(D/H)-box helicase that can recognize RNA(PMID: 18411269). It acts as a positive, but not negative, regulator of RIG-I-and MDA5-dependent recognition of RNA virus infection and plays a pivotal role in antiviral responses in vivo(PMID:20080593).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; RIG-I-like receptors direct inflammatory macrophage polarization against West Nile virus infection.; Authors - Amy E L Stone ; KO Validated
human	WB	Nucleic Acids Res; miR-122 does not impact recognition of the HCV genome by innate sensors of RNA but rather protects the 5' end from the cellular pyrophosphatases, DOM3Z and DUSP11.; Authors - Yalena Amador-Cañizares
human	WB	EMBO Rep; RNA sensor LGP2 inhibits TRAF ubiquitin ligase to negatively regulate innate immune signaling.; Authors - Jean-Patrick Parisien
pig,monkey,human	WB,IP,IF	J Virol; LGP2 Promotes Type I Interferon Production To Inhibit PRRSV Infection via Enhancing MDA5-Mediated Signaling; Authors - Zhenbang Zhu ; KD Validated
mouse,human	WB	J Virol; Ambivalent role of the innate immune response in rabies virus pathogenesis.; Authors - Chopy Damien D
mouse,human	WB,IP,IHC	Cancer Sci; Innate immune sensor laboratory of genetics and physiology 2 suppresses tumor cell growth and functions as a prognostic marker in neuroblastoma.; Authors - Li-Ling Lin