DDX3 Monoclonal antibody

DDX3 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67915-1-Ig
Clone No.1D3A1

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA

DDX3X, DDX14, DBX, CAP-Rf, ATP-dependent RNA helicase DDX3X

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67915-1-Ig targets DDX3 in WB, IHC, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, rat, hamster
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29972

Product name: Recombinant human DDX3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 312-662 aa of BC011819

Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
Calculated Molecular Weight 73 kDa
Observed Molecular Weight71-73 kDa
GenBank Accession NumberBC011819
Gene Symbol DDX3
Gene ID (NCBI) 1654
RRIDAB_2918669
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00571
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX3X, also named DBX, DDX3, and HLP2, belongs to the DEAD-box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73kd is the target band. 60-65kd is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.

Protocols

Product Specific Protocols
FC protocol for DDX3 antibody 67915-1-IgDownload protocol
IHC protocol for DDX3 antibody 67915-1-IgDownload protocol
WB protocol for DDX3 antibody 67915-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Sci Adv

PARP14 is a PARP with both ADP-ribosyl transferase and hydrolase activities

Authors - Nina Đukić
ratIF

CNS Neurosci Ther

A novel stroke rehabilitation strategy and underlying stress granule regulations through inhibition of NLRP3 inflammasome activation

Authors - Qingzhu Wang
humanWB

Int Immunopharmacol

Bortezomib induces cell apoptosis and increases the efficacy of αPD-1 in BCR::ABL T315I mutation CML by targeting UBE2Q1

Authors - Fengyu Jiang
human,hamsterWB,CoIP

Adv Sci (Weinh)

DDX3 Regulates the Cap-Independent Translation of the Japanese Encephalitis Virus via Its Interactions with PABP1 and the Untranslated Regions of the Viral Genome

Authors - Chenxi Li
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...