Connexin 43 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Connexin 43 Polyclonal antibody (26980-1-AP)

Connexin 43 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 26980-1-AP

Publications(117)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

Synonyms

GJA1, Connexin-43, GJAL, Gap junction alpha-1 protein, Gap junction alpha 1 protein

• 

  WB analysis using 26980-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26980-1-AP (Connexin 43 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 26980-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 26980-1-AP

  IP result of anti-Connexin 43 (IP:26980-1-AP, 4ug; Detection:26980-1-AP 1:500) with mouse heart tissue lysate 4000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26980-1-AP (Connexin 43 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26980-1-AP (Connexin 43 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 26980-1-AP (Connexin 43 antibody) at dilution of 1:50 and 66895-1-Ig (alpha Actinin mouse mAb) at dilution of 1:50, further stained with CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) for 26980-1-AP, and CoraLite594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) for 66895-1-Ig.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Connexin 43 antibody (26980-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Connexin 43 antibody (26980-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human heart tissue using 26980-1-AP (Connexin 43 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse testis tissue, mouse heart tissue, rat brain tissue, rat heart tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: rat heart tissue, mouse heart tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue, human heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26980-1-AP targets Connexin 43 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25533

  Product name: Recombinant human Connexin 43 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 232-382 aa of BC026329

  Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

• Full Name: gap junction protein, alpha 1, 43kDa
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43-47 kDa
• GenBank Accession Number: BC026329
• Gene Symbol: Connexin-43
• Gene ID (NCBI): 2697
• RRID: AB_2880711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17302
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Connexin-43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Cx43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
canine	WB	Eur Heart J; Left bundle branch vs biventricular pacing: mechanistic insights from a canine model.; Authors - Hao Huang
rat	WB	Nat Nanotechnol; Oral mitochondrial transplantation using nanomotors to treat ischaemic heart disease.; Authors - Ziyu Wu
mouse	WB	Immunity; OAS cross-activates RNase L intercellularly through cell-to-cell transfer of 2-5A to spread innate immunity; Authors - Wanwan Huai
mouse	IF	Nat Aging; Mevalonate metabolites boost aged oocyte quality through prenylation of small GTPases.; Authors - Chuanming Liu
mouse	WB	J Extracell Vesicles; Umbilical Cord-Mesenchymal Stromal Cell-Derived Extracellular Vesicles Target the Liver to Improve Neurovascular Health in Type 2 Diabetes With Non-Alcoholic Fatty Liver Disease; Authors - Minghao Du
mouse	WB	Nat Commun; Targeting APLN/APJ restores blood-testis barrier and improves spermatogenesis in murine and human diabetic models; Authors - Ke Song

Reviews

5.0 out of 5

3 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Sama (Verified Customer) (03-26-2026)

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse brain slice

Connexin 43 Antibody Immunofluorescence validation (1:1000 dilution) in Mouse brain slice (Cat no:26980-1-AP)

Muhammad (Verified Customer) (08-30-2022)

Cx43 antibody used is excellent and working in HUVEC cells.

• Applications: Western Blot
• Cell Tissue Type: HUVEC

ABDULLAH (Verified Customer) (11-08-2019)

This antibody worked great!It detected the protein at the right size.There wasn't any background.

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: BEND.3 cells