• Featured Product
  • KD/KO Validated

Collagen Type III (N-terminal) Polyclonal antibody, PBS Only

Collagen Type III (N-terminal) Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA
Cat No. 22734-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

COL3, COL3A1, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain, Collagen Type III

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

22734-1-PBS targets Collagen Type III (N-terminal) in WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18658

Product name: Recombinant human COL3A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-152 aa of BC028178

Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS

Predict reactive species
Full Name collagen, type III, alpha 1
Calculated Molecular Weight 1466 aa, 139 kDa
Observed Molecular Weight 140-180 kDa
GenBank Accession NumberBC028178
Gene Symbol COL3A1
Gene ID (NCBI) 1281
RRIDAB_2879158
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02461
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen detects type III procollagen at 140-180 kDa and also in some lysates reveals a 70-kDa band which has been reported and may represent a cleaved form of type III procollagen (PMID: 17424834; 19648160; 22802960).

Loading...
||
New chat Able
正在加载,请稍候...