Tested Applications
| Positive WB detected in | unboiled mouse lung tissue, unboiled rat lung tissue |
| Positive IHC detected in | human colon tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 33 publications below |
| IF | See 6 publications below |
Product Information
29767-1-AP targets Claudin 5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29044 Product name: Recombinant human CLDN5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 144-218 aa of BC032363 Sequence: VREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV Predict reactive species |
| Full Name | claudin 5 |
| Calculated Molecular Weight | 218 aa, 23 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC032363 |
| Gene Symbol | CLDN5 |
| Gene ID (NCBI) | 7122 |
| RRID | AB_2935477 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00501 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 27 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Claudin 5 antibody 29767-1-AP | Download protocol |
| IHC protocol for Claudin 5 antibody 29767-1-AP | Download protocol |
| WB protocol for Claudin 5 antibody 29767-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mater Today Bio Endoscopic nasal delivery of engineered endothelial progenitor cell-derived exosomes improves angiogenesis and neurological deficits in rats with intracerebral hemorrhage | ||
Adv Healthc Mater Colon-Targeted Ginseng Polysaccharides-Based Microspheres for Improving Ulcerative Colitis via Anti-Inflammation and Gut Microbiota Modulation | ||
Phytomedicine Ginger-processed Magnoliae Officinalis Cortex ameliorates ovalbumin-induced asthma by alleviating inflammation via the gut-lung axis | ||
Microbiol Res Trojan horse strategy and TfR/ LDLR-Mediated transcytosis determine the dissemination of mycobacteria in tuberculous meningoencephalitis | ||
Life Sci Metabolomics study reveals increased deoxycholic acid contributes to deoxynivalenol-mediated intestinal barrier injury | ||
Int J Mol Sci Ursolic Acid Alleviates Neuroinflammation after Intracerebral Hemorrhage by Mediating Microglial Pyroptosis via the NF-κB/NLRP3/GSDMD Pathway |









