Caveolin-3 Polyclonal antibody

• 

  WB analysis of mouse colon using 28358-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 28358-1-AP (Caveolin-3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 28358-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 28358-1-AP (Caveolin-3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 28358-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 28358-1-AP (Caveolin-3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 28358-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 28358-1-AP (Caveolin-3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 28358-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 28358-1-AP (Caveolin-3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skeletal muscle using 28358-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 28358-1-AP (Caveolin-3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skeletal muscle using 28358-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 28358-1-AP (Caveolin-3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 28358-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28358-1-AP (Caveolin-3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 28358-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28358-1-AP (Caveolin-3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse skeletal muscle using 28358-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using Caveolin-3 antibody (28358-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse skeletal muscle using 28358-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using Caveolin-3 antibody (28358-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of H9C2 using 28358-1-AP

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using Caveolin-3 antibody (28358-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

Caveolin-3 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 28358-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

CAV3, Caveolin3, M-caveolin, LQT9, LGMD1C

---

Tested Applications

• Positive WB detected in: mouse colon tissue, mouse heart tissue, mouse skeletal muscle tissue
• Positive IHC detected in: mouse heart tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse skeletal muscle tissue
• Positive IF/ICC detected in: H9C2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

28358-1-AP targets Caveolin-3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28009

  Product name: Recombinant human Caveolin-3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-40 aa of BC069368

  Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVD

• Full Name: caveolin 3
• Calculated Molecular Weight: 151 aa, 17 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC069368
• Gene Symbol: Caveolin-3
• Gene ID (NCBI): 859
• RRID: AB_2881120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56539
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Oxid Med Cell Longev; Trophoblasts Modulate the Ca2+ Oscillation and Contraction of Myometrial Smooth Muscle Cells by Small Extracellular Vesicle- (sEV-) Mediated Exporting of miR-25-3p during Premature Labor.; Authors - Lin Wang
mouse	WB	Cell Metab; Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining; Authors - Ya Liu
rat	WB,IF	Int Heart J; Decrease in Caveolae-Gαq Interaction Mediates Pressure Overload-Induced Cardiac Remodeling in Rats; Authors - Lijin Wang