GM-CSF Polyclonal antibody

• 

  WB analysis using 17762-1-AP

  PMA, Ionomycin and Brefeldin A treated NK-92 cells were subjected to SDS PAGE followed by western blot with 17762-1-AP (GM-CSF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

GM-CSF Polyclonal Antibody for WB, ELISA

Cat No. 17762-1-AP

Publications(33)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

CSF2, Colony stimulating factor, Colony Stimulating Factor 2, Colony-stimulating factor, CSF

---

Tested Applications

• Positive WB detected in: NK-92 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 20 publications below
• IHC: See 12 publications below
• IF: See 6 publications below

Product Information

17762-1-AP targets GM-CSF in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12142

  Product name: Recombinant human CSF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC108724

  Sequence: MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE

• Full Name: colony stimulating factor 2 (granulocyte-macrophage)
• Calculated Molecular Weight: 144 aa, 16 kDa
• Observed Molecular Weight: 15kDa,18 kDa ,22 kDa
• GenBank Accession Number: BC108724
• Gene Symbol: GM-CSF
• Gene ID (NCBI): 1437
• RRID: AB_2276718
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04141
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts. GM-CSF is a hematopoietic growth factor that stimulates the development of early erythroid megakaryocytic and eosinophilic progenitor cells (PMID 2990035). GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes (PMID 3021817, 2984574, 6390681).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Hematol Oncol; FFAR2 expressing myeloid-derived suppressor cells drive cancer immunoevasion; Authors - Zeda Zhao
	WB	Adv Sci (Weinh); Modular Hydrogel Vaccine for Programmable and Coordinate Elicitation of Cancer Immunotherapy; Authors - Panpan Ji
human	WB,IHC	J Exp Med; Tumoral EHF predicts the efficacy of anti-PD1 therapy in pancreatic ductal adenocarcinoma.; Authors - Jing Liu
mouse	IF	J Am Soc Nephrol; Tubular GM-CSF Promotes Late MCP-1/CCR2-Mediated Fibrosis and Inflammation after Ischemia/Reperfusion Injury.; Authors - Leyuan Xu
mouse	WB,IHC,IF	Acta Pharmacol Sin; Macrophages promote the transition from myocardial ischemia reperfusion injury to cardiac fibrosis in mice through GMCSF/CCL2/CCR2 and phenotype switching; Authors - Shi-Chun Shen
mouse,human	WB	Oncogene; CMAHP promotes metastasis by reducing ubiquitination of Snail and inducing angiogenesis via GM-CSF overexpression in gastric cancer.; Authors - Hsiang-Wei Huang