CoraLite® Plus 488-conjugated CSF1R/CD115 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-25949

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 CSF1R antibody (CL488-25949) at dilution of 1:200.

• 

  IF Staining of THP-1 using CL488-25949

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using CoraLite® Plus 488 CSF1R/CD115 antibody (CL488-25949) at dilution of 1:200.

CSF1R/CD115 Polyclonal Antibody for IF/ICC

Cat No. CL488-25949

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CSF1R, C FMS, CD115, CSF 1 R, CSF-1 receptor

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells, THP-1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25949 targets CSF1R/CD115 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22845

  Product name: Recombinant human CSF1R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-369 aa of BC047521

  Sequence: IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIHQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANVTTKDTYRHTFTLSLP

• Full Name: colony stimulating factor 1 receptor
• Calculated Molecular Weight: 972 aa, 108 kDa
• GenBank Accession Number: BC047521
• Gene Symbol: CSF1R/CD115
• Gene ID (NCBI): 1436
• RRID: AB_3084094
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07333
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.