CRIP1 Recombinant monoclonal antibody

• 

  WB analysis using 83340-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83340-3-RR (CRIP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 83340-3-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 83340-3-RR (CRIP1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83340-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83340-3-RR against Human CRIP1 were performed. The affinity constant is 0.784 nM.

CRIP1 Recombinant Antibody for WB, IHC, ELISA

Cat No. 83340-3-RR

Clone No.240176G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CRP1, CRP 1, CRIP 1, CRIP, CRHP

---

Tested Applications

• Positive WB detected in: T-47D cells, HeLa cells, mouse colon tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83340-3-RR targets CRIP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7588

  Product name: Recombinant human CRIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-77 aa of BC002738

  Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

• Full Name: cysteine-rich protein 1 (intestinal)
• Calculated Molecular Weight: 9 kDa
• Observed Molecular Weight: 8-9 kDa
• GenBank Accession Number: BC002738
• Gene Symbol: CRIP1
• Gene ID (NCBI): 1396
• RRID: AB_3671000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50238
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRIP1 also known as CRIP, CRP1, belongs to the LIM/double zinc finger protein family. CRIP1 has a unique double zinc finger motif, which is mainly expressed in the intestine, and may be involved in intestinal zinc transport (PMID: 31312368, 1946385). CRIP1 is overexpressed in immune cells of the epithelium and may play an important role in gut immunity(PMID: 27836662).